BLASTX nr result
ID: Cheilocostus21_contig00009908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00009908 (506 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418627.1| PREDICTED: uncharacterized protein LOC103998... 68 3e-10 >ref|XP_009418627.1| PREDICTED: uncharacterized protein LOC103998773 [Musa acuminata subsp. malaccensis] Length = 612 Score = 68.2 bits (165), Expect = 3e-10 Identities = 36/53 (67%), Positives = 44/53 (83%) Frame = +2 Query: 2 GSTATEVCKEASRLLEEMKKKAFGPLTDAVIQEALSLASKNDSVPTKDMRVQH 160 GS A + +EA++ LEE+KKKAFG LT+ VIQEALSLAS+NDSVP+KD VQH Sbjct: 562 GSNAKDELEEAAKHLEELKKKAFGSLTEEVIQEALSLASRNDSVPSKD--VQH 612