BLASTX nr result
ID: Cheilocostus21_contig00009811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00009811 (732 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020090579.1| cytochrome c oxidase copper chaperone 1-like... 99 6e-23 gb|OAY69365.1| Cytochrome c oxidase copper chaperone 1, partial ... 99 7e-23 gb|KQJ90266.1| hypothetical protein BRADI_4g30460v3 [Brachypodiu... 96 3e-22 ref|XP_002285003.1| PREDICTED: cytochrome c oxidase copper chape... 96 3e-22 ref|XP_010942087.1| PREDICTED: cytochrome c oxidase copper chape... 98 3e-22 ref|XP_022854605.1| cytochrome c oxidase copper chaperone 2-like... 96 4e-22 ref|XP_006406979.1| cytochrome c oxidase copper chaperone 1 isof... 96 4e-22 ref|XP_024015043.1| cytochrome c oxidase copper chaperone 1 isof... 96 4e-22 ref|XP_010235917.1| PREDICTED: cytochrome c oxidase copper chape... 96 5e-22 ref|XP_019055740.1| PREDICTED: cytochrome c oxidase copper chape... 96 7e-22 gb|PON91164.1| Cytochrome c oxidase copper chaperone [Trema orie... 95 1e-21 ref|XP_020417709.1| cytochrome c oxidase copper chaperone 1 [Pru... 95 1e-21 ref|XP_020177419.1| cytochrome c oxidase copper chaperone 1-like... 95 1e-21 gb|EMS64625.1| Cytochrome c oxidase copper chaperone [Triticum u... 95 1e-21 gb|OEL32961.1| Cytochrome c oxidase copper chaperone 1, partial ... 95 2e-21 ref|XP_020554450.1| cytochrome c oxidase copper chaperone 2 [Ses... 94 2e-21 ref|XP_008226635.1| PREDICTED: cytochrome c oxidase copper chape... 94 2e-21 ref|XP_020151350.1| cytochrome c oxidase copper chaperone 2 [Aeg... 94 3e-21 ref|XP_015623014.1| PREDICTED: cytochrome c oxidase copper chape... 94 3e-21 emb|CDP05919.1| unnamed protein product [Coffea canephora] 94 3e-21 >ref|XP_020090579.1| cytochrome c oxidase copper chaperone 1-like [Ananas comosus] ref|XP_020090580.1| cytochrome c oxidase copper chaperone 1-like [Ananas comosus] Length = 111 Score = 99.4 bits (246), Expect = 6e-23 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 7/80 (8%) Frame = -1 Query: 519 MSN-EVASPMNSRLAGPSAIREEGIVDTKP------KKICCACPDTKRIRDQCIVEHGEA 361 MSN EV P+ S+ P A E P KKICCACPDTK++RD+CIVEHGEA Sbjct: 32 MSNVEVGMPLPSKSPQPPAASEALTSPNPPPESKPKKKICCACPDTKKLRDECIVEHGEA 91 Query: 360 ACGKWIEAHMRCLRAEGFKV 301 ACGKWIEAH +CLRAEGFKV Sbjct: 92 ACGKWIEAHKQCLRAEGFKV 111 >gb|OAY69365.1| Cytochrome c oxidase copper chaperone 1, partial [Ananas comosus] Length = 116 Score = 99.4 bits (246), Expect = 7e-23 Identities = 50/80 (62%), Positives = 56/80 (70%), Gaps = 7/80 (8%) Frame = -1 Query: 519 MSN-EVASPMNSRLAGPSAIREEGIVDTKP------KKICCACPDTKRIRDQCIVEHGEA 361 MSN EV P+ S+ P A E P KKICCACPDTK++RD+CIVEHGEA Sbjct: 37 MSNVEVGMPLPSKSPQPPAASEALTSPNPPPESKPKKKICCACPDTKKLRDECIVEHGEA 96 Query: 360 ACGKWIEAHMRCLRAEGFKV 301 ACGKWIEAH +CLRAEGFKV Sbjct: 97 ACGKWIEAHKQCLRAEGFKV 116 >gb|KQJ90266.1| hypothetical protein BRADI_4g30460v3 [Brachypodium distachyon] Length = 73 Score = 96.3 bits (238), Expect = 3e-22 Identities = 44/62 (70%), Positives = 50/62 (80%), Gaps = 4/62 (6%) Frame = -1 Query: 474 PSAIREEG---IVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGF 307 P + E G DTKPKK ICCACPDTK++RD+CIV+HGE ACGKWIEAH +CLRAEGF Sbjct: 12 PDSAEEAGQAPAADTKPKKKICCACPDTKKLRDECIVQHGEDACGKWIEAHRQCLRAEGF 71 Query: 306 KV 301 KV Sbjct: 72 KV 73 >ref|XP_002285003.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Vitis vinifera] ref|XP_010644199.1| PREDICTED: cytochrome c oxidase copper chaperone 2 [Vitis vinifera] Length = 75 Score = 96.3 bits (238), Expect = 3e-22 Identities = 45/61 (73%), Positives = 46/61 (75%) Frame = -1 Query: 483 LAGPSAIREEGIVDTKPKKICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFK 304 LAG R V KKICCACPDTK+IRD CIVEHGEAAC KWIEAH RCLRAEGFK Sbjct: 15 LAGLQQTRGSEPVSKPKKKICCACPDTKKIRDDCIVEHGEAACEKWIEAHRRCLRAEGFK 74 Query: 303 V 301 V Sbjct: 75 V 75 >ref|XP_010942087.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Elaeis guineensis] Length = 124 Score = 97.8 bits (242), Expect = 3e-22 Identities = 47/76 (61%), Positives = 56/76 (73%), Gaps = 6/76 (7%) Frame = -1 Query: 510 EVASPMNSRLAGPSAIREEGIV-----DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGK 349 EV P+ S+ P AI + D+KPKK ICCACPDTKR+RD+CIV+HGEAAC K Sbjct: 49 EVGMPLQSKSPEPPAISQNLAAAGPTPDSKPKKKICCACPDTKRLRDECIVQHGEAACEK 108 Query: 348 WIEAHMRCLRAEGFKV 301 WI+AH +CLRAEGFKV Sbjct: 109 WIQAHKQCLRAEGFKV 124 >ref|XP_022854605.1| cytochrome c oxidase copper chaperone 2-like [Olea europaea var. sylvestris] Length = 78 Score = 96.3 bits (238), Expect = 4e-22 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = -1 Query: 444 DTKPKKICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KPKKICCACPDTK++RD+CIVEHGE+AC KWIEAH RCLR+EGF V Sbjct: 31 DSKPKKICCACPDTKKLRDECIVEHGESACEKWIEAHKRCLRSEGFNV 78 >ref|XP_006406979.1| cytochrome c oxidase copper chaperone 1 isoform X2 [Eutrema salsugineum] gb|ESQ48432.1| hypothetical protein EUTSA_v10021884mg [Eutrema salsugineum] Length = 70 Score = 95.9 bits (237), Expect = 4e-22 Identities = 43/59 (72%), Positives = 48/59 (81%), Gaps = 1/59 (1%) Frame = -1 Query: 474 PSAIREEGIVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 P AI E +TKPKK ICCACPDTK++RD+CIVEHGE+AC KWIEAH CLRAEGF V Sbjct: 12 PPAISEPSKAETKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHKMCLRAEGFNV 70 >ref|XP_024015043.1| cytochrome c oxidase copper chaperone 1 isoform X1 [Eutrema salsugineum] Length = 73 Score = 95.9 bits (237), Expect = 4e-22 Identities = 43/59 (72%), Positives = 48/59 (81%), Gaps = 1/59 (1%) Frame = -1 Query: 474 PSAIREEGIVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 P AI E +TKPKK ICCACPDTK++RD+CIVEHGE+AC KWIEAH CLRAEGF V Sbjct: 15 PPAISEPSKAETKPKKRICCACPDTKKLRDECIVEHGESACTKWIEAHKMCLRAEGFNV 73 >ref|XP_010235917.1| PREDICTED: cytochrome c oxidase copper chaperone 2-like [Brachypodium distachyon] gb|KQK01132.1| hypothetical protein BRADI_3g54010v3 [Brachypodium distachyon] Length = 75 Score = 95.9 bits (237), Expect = 5e-22 Identities = 42/49 (85%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KPKK ICCACPDTKR+RD+CIVEHGE+AC KWIEAH RCLRAEGFKV Sbjct: 27 DSKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHKRCLRAEGFKV 75 >ref|XP_019055740.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Nelumbo nucifera] ref|XP_019055741.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Nelumbo nucifera] ref|XP_019055742.1| PREDICTED: cytochrome c oxidase copper chaperone 1-like [Nelumbo nucifera] Length = 79 Score = 95.5 bits (236), Expect = 7e-22 Identities = 39/50 (78%), Positives = 45/50 (90%) Frame = -1 Query: 450 IVDTKPKKICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 + + KPKKICCACP+TKR+RD+CIVEHGEAAC KWIEAH+ CLRAEGF V Sbjct: 30 VANAKPKKICCACPNTKRLRDECIVEHGEAACTKWIEAHLACLRAEGFNV 79 >gb|PON91164.1| Cytochrome c oxidase copper chaperone [Trema orientalis] Length = 80 Score = 95.1 bits (235), Expect = 1e-21 Identities = 40/49 (81%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 +TKPKK ICCACPDTK++RD+CIVEHGE ACGKWIEAH++CLRAEGF V Sbjct: 32 ETKPKKKICCACPDTKKLRDECIVEHGEEACGKWIEAHLKCLRAEGFNV 80 >ref|XP_020417709.1| cytochrome c oxidase copper chaperone 1 [Prunus persica] ref|XP_020417710.1| cytochrome c oxidase copper chaperone 1 [Prunus persica] ref|XP_020417711.1| cytochrome c oxidase copper chaperone 1 [Prunus persica] ref|XP_020417712.1| cytochrome c oxidase copper chaperone 1 [Prunus persica] gb|ONI12757.1| hypothetical protein PRUPE_4G181400 [Prunus persica] gb|ONI12758.1| hypothetical protein PRUPE_4G181400 [Prunus persica] Length = 81 Score = 95.1 bits (235), Expect = 1e-21 Identities = 45/73 (61%), Positives = 56/73 (76%), Gaps = 1/73 (1%) Frame = -1 Query: 516 SNEVASPMNSRLAGPSAIREEGIVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIE 340 S+ +A P + G SA+ +DTKPKK ICCACPDTK++RD+CIVEHG+ AC KWI+ Sbjct: 10 SSALAFPGSQPTQG-SAVTTAPSLDTKPKKKICCACPDTKKLRDECIVEHGQEACTKWID 68 Query: 339 AHMRCLRAEGFKV 301 AH+RCLRAEGF V Sbjct: 69 AHLRCLRAEGFNV 81 >ref|XP_020177419.1| cytochrome c oxidase copper chaperone 1-like [Aegilops tauschii subsp. tauschii] Length = 73 Score = 94.7 bits (234), Expect = 1e-21 Identities = 42/49 (85%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 DTKPKK ICCACPDTKR+RD+CIVEHGE ACGKWIEAH CLRAEGF V Sbjct: 25 DTKPKKKICCACPDTKRLRDECIVEHGEDACGKWIEAHRLCLRAEGFNV 73 >gb|EMS64625.1| Cytochrome c oxidase copper chaperone [Triticum urartu] Length = 73 Score = 94.7 bits (234), Expect = 1e-21 Identities = 42/49 (85%), Positives = 44/49 (89%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 DTKPKK ICCACPDTKR+RD+CIVEHGE ACGKWIEAH CLRAEGF V Sbjct: 25 DTKPKKKICCACPDTKRLRDECIVEHGEDACGKWIEAHRLCLRAEGFNV 73 >gb|OEL32961.1| Cytochrome c oxidase copper chaperone 1, partial [Dichanthelium oligosanthes] Length = 91 Score = 94.7 bits (234), Expect = 2e-21 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KPKK ICCACPDTKR+RD+CIVEHGE+AC KWIEAH RCLRAEGF V Sbjct: 43 DSKPKKKICCACPDTKRLRDECIVEHGESACSKWIEAHKRCLRAEGFNV 91 >ref|XP_020554450.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] ref|XP_020554451.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] ref|XP_020554452.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] Length = 79 Score = 94.4 bits (233), Expect = 2e-21 Identities = 40/49 (81%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKP-KKICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KP KKICCACP+TK++RD+CIVEHGEAACGKWIEAH +CLRAEGF V Sbjct: 31 DSKPRKKICCACPETKKLRDECIVEHGEAACGKWIEAHRKCLRAEGFNV 79 >ref|XP_008226635.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Prunus mume] Length = 81 Score = 94.4 bits (233), Expect = 2e-21 Identities = 41/58 (70%), Positives = 49/58 (84%), Gaps = 1/58 (1%) Frame = -1 Query: 471 SAIREEGIVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 SA+ +DTKPKK ICCACPDTK++RD+CIVEHG+ AC KWI+AH+RCLRAEGF V Sbjct: 24 SAVTTAPSLDTKPKKKICCACPDTKKLRDECIVEHGQEACTKWIDAHLRCLRAEGFNV 81 >ref|XP_020151350.1| cytochrome c oxidase copper chaperone 2 [Aegilops tauschii subsp. tauschii] Length = 76 Score = 94.0 bits (232), Expect = 3e-21 Identities = 46/70 (65%), Positives = 54/70 (77%), Gaps = 1/70 (1%) Frame = -1 Query: 507 VASPMNSRLAGPSAIREEGIVDTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHM 331 V S +NS A P+ D+KPKK ICCACPDTKR+RD+CIVE+GE+AC KWIEAH Sbjct: 14 VCSIVNSGPAAPAT-------DSKPKKKICCACPDTKRLRDECIVEYGESACTKWIEAHK 66 Query: 330 RCLRAEGFKV 301 +CLRAEGFKV Sbjct: 67 QCLRAEGFKV 76 >ref|XP_015623014.1| PREDICTED: cytochrome c oxidase copper chaperone 1 [Oryza sativa Japonica Group] dbj|BAD19263.1| putative copper chaperone COX17-1 [Oryza sativa Japonica Group] dbj|BAD19672.1| putative copper chaperone COX17-1 [Oryza sativa Japonica Group] dbj|BAF10292.1| Os02g0794600 [Oryza sativa Japonica Group] gb|EEC74165.1| hypothetical protein OsI_09266 [Oryza sativa Indica Group] gb|EEE57965.1| hypothetical protein OsJ_08703 [Oryza sativa Japonica Group] dbj|BAS81348.1| Os02g0794600 [Oryza sativa Japonica Group] Length = 79 Score = 94.0 bits (232), Expect = 3e-21 Identities = 41/49 (83%), Positives = 45/49 (91%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKPKK-ICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KPKK ICCACPDTKR+RD+CIVEHGE+AC KWIEAH RCLRAEGF V Sbjct: 31 DSKPKKKICCACPDTKRLRDECIVEHGESACTKWIEAHKRCLRAEGFNV 79 >emb|CDP05919.1| unnamed protein product [Coffea canephora] Length = 79 Score = 94.0 bits (232), Expect = 3e-21 Identities = 39/49 (79%), Positives = 46/49 (93%), Gaps = 1/49 (2%) Frame = -1 Query: 444 DTKP-KKICCACPDTKRIRDQCIVEHGEAACGKWIEAHMRCLRAEGFKV 301 D+KP KKICCACP+TK++RD+C+VEHGEAACGKWIEAH +CLRAEGF V Sbjct: 31 DSKPRKKICCACPETKKLRDECVVEHGEAACGKWIEAHRKCLRAEGFNV 79