BLASTX nr result
ID: Cheilocostus21_contig00009802
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00009802 (776 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AHF20178.1| phenylalanine ammonia lyase, partial [Musa acumin... 104 8e-22 ref|XP_009384657.1| PREDICTED: phenylalanine ammonia-lyase-like ... 103 2e-21 ref|XP_009401948.1| PREDICTED: phenylalanine ammonia-lyase-like ... 103 2e-21 ref|XP_009413725.2| PREDICTED: phenylalanine ammonia-lyase-like ... 103 2e-21 gb|AOS51473.1| phenylalanine ammonia-lyase, partial [Daemonorops... 101 9e-21 gb|ATG23645.1| phenylalanine ammonia lyase [Metroxylon sagu] 101 1e-20 gb|AFR41231.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 2e-20 gb|AFR41233.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 2e-20 gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 2e-20 gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 2e-20 gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 2e-20 dbj|BAF98438.1| phenylalanine ammonia-lyase, partial [Glehnia li... 97 4e-20 gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 5e-20 ref|XP_009383964.1| PREDICTED: phenylalanine ammonia-lyase-like ... 100 5e-20 gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nig... 92 5e-20 gb|AFR41232.1| phenylalanine ammonia-lyase, partial [Populus nigra] 92 5e-20 ref|XP_020084519.1| LOW QUALITY PROTEIN: phenylalanine ammonia-l... 99 6e-20 gb|OAY82644.1| Phenylalanine ammonia-lyase 3 [Ananas comosus] 99 7e-20 ref|XP_009421282.1| PREDICTED: phenylalanine ammonia-lyase-like ... 99 9e-20 gb|AFR41235.1| phenylalanine ammonia-lyase, partial [Populus nigra] 91 9e-20 >gb|AHF20178.1| phenylalanine ammonia lyase, partial [Musa acuminata AAA Group] Length = 600 Score = 104 bits (260), Expect = 8e-22 Identities = 48/53 (90%), Positives = 50/53 (94%) Frame = +1 Query: 4 VREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 VREELG AYLTGEKARSPGEEFDKV VA+N GLLIDPLLECLKEWNGAP+PIC Sbjct: 548 VREELGVAYLTGEKARSPGEEFDKVFVAVNEGLLIDPLLECLKEWNGAPLPIC 600 >ref|XP_009384657.1| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. malaccensis] Length = 713 Score = 103 bits (258), Expect = 2e-21 Identities = 46/54 (85%), Positives = 51/54 (94%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVR+ELGAAYLTGEK RSPGEEFDKV A+N+GLLIDPL+ECLKEWNGAP+PIC Sbjct: 660 FVRKELGAAYLTGEKVRSPGEEFDKVFAAINKGLLIDPLMECLKEWNGAPLPIC 713 >ref|XP_009401948.1| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. malaccensis] Length = 711 Score = 103 bits (257), Expect = 2e-21 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = +1 Query: 4 VREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 VREELG AYLTGEKARSPGEEFDKV +A+N GLLIDPLLECLKEWNGAP+PIC Sbjct: 659 VREELGVAYLTGEKARSPGEEFDKVFMAVNEGLLIDPLLECLKEWNGAPLPIC 711 >ref|XP_009413725.2| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. malaccensis] Length = 749 Score = 103 bits (257), Expect = 2e-21 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG AYLTGEK RSPGEEFDKV A+NRG LIDPLLECLKEWNGAP+PIC Sbjct: 696 FVREELGTAYLTGEKVRSPGEEFDKVFAAINRGQLIDPLLECLKEWNGAPLPIC 749 >gb|AOS51473.1| phenylalanine ammonia-lyase, partial [Daemonorops jenkinsiana] Length = 557 Score = 101 bits (252), Expect = 9e-21 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELGA YLTGEKARSPGEEF+KV VA++RGL+IDPL ECLKEWNGAP+P+C Sbjct: 504 FVREELGAGYLTGEKARSPGEEFNKVFVAISRGLVIDPLFECLKEWNGAPLPLC 557 >gb|ATG23645.1| phenylalanine ammonia lyase [Metroxylon sagu] Length = 704 Score = 101 bits (252), Expect = 1e-20 Identities = 45/54 (83%), Positives = 51/54 (94%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELGA YLTGEKARSPGEEF+KV VA++RGL+IDPL ECLKEWNGAP+P+C Sbjct: 651 FVREELGAGYLTGEKARSPGEEFNKVFVAISRGLVIDPLFECLKEWNGAPLPLC 704 >gb|AFR41231.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 92.4 bits (228), Expect = 2e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 27 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 80 >gb|AFR41233.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 81 Score = 92.4 bits (228), Expect = 2e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 28 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 81 >gb|AFR41238.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 84 Score = 92.4 bits (228), Expect = 2e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 31 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 84 >gb|AFR41239.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 86 Score = 92.4 bits (228), Expect = 2e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 33 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 86 >gb|AFR41236.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 91 Score = 92.4 bits (228), Expect = 2e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 38 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 91 >dbj|BAF98438.1| phenylalanine ammonia-lyase, partial [Glehnia littoralis] Length = 267 Score = 96.7 bits (239), Expect = 4e-20 Identities = 43/54 (79%), Positives = 47/54 (87%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG YLTGEK RSPGEEFDKV AM+RG +IDPLLECL+ WNGAP+PIC Sbjct: 214 FVREELGTEYLTGEKVRSPGEEFDKVFTAMSRGEIIDPLLECLESWNGAPLPIC 267 >gb|AFR41237.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 117 Score = 92.4 bits (228), Expect = 5e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 64 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 117 >ref|XP_009383964.1| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. malaccensis] Length = 700 Score = 99.8 bits (247), Expect = 5e-20 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG YLTGEK RSPGEEFDKV VA++RGL+IDPLLECLKEWNG P+P+C Sbjct: 647 FVREELGTEYLTGEKVRSPGEEFDKVFVAIDRGLVIDPLLECLKEWNGVPLPMC 700 >gb|AFR41234.1| phenylalanine ammonia-lyase, partial [Populus nigra] gb|AFR41240.1| phenylalanine ammonia-lyase, partial [Populus nigra] gb|AFR41241.1| phenylalanine ammonia-lyase, partial [Populus nigra] gb|AFR41242.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 92.4 bits (228), Expect = 5e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 67 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 120 >gb|AFR41232.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 92.4 bits (228), Expect = 5e-20 Identities = 42/54 (77%), Positives = 46/54 (85%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDKV A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 67 FVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNGAPLPIC 120 >ref|XP_020084519.1| LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like [Ananas comosus] Length = 619 Score = 99.4 bits (246), Expect = 6e-20 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG YLTGEK RSPGEEFDKV VA+N G LIDPLLECLKEWNG P+PIC Sbjct: 566 FVREELGTEYLTGEKVRSPGEEFDKVFVAINEGKLIDPLLECLKEWNGEPLPIC 619 >gb|OAY82644.1| Phenylalanine ammonia-lyase 3 [Ananas comosus] Length = 716 Score = 99.4 bits (246), Expect = 7e-20 Identities = 45/54 (83%), Positives = 47/54 (87%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG YLTGEK RSPGEEFDKV VA+N G LIDPLLECLKEWNG P+PIC Sbjct: 663 FVREELGTEYLTGEKVRSPGEEFDKVFVAINEGKLIDPLLECLKEWNGEPLPIC 716 >ref|XP_009421282.1| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. malaccensis] Length = 711 Score = 99.0 bits (245), Expect = 9e-20 Identities = 46/54 (85%), Positives = 48/54 (88%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG A LTGEK RSPGEEFDKV VA+N G LIDPLLECLKEWNGAP+PIC Sbjct: 658 FVREELGTACLTGEKVRSPGEEFDKVFVAINGGSLIDPLLECLKEWNGAPLPIC 711 >gb|AFR41235.1| phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 90.5 bits (223), Expect = 9e-20 Identities = 41/54 (75%), Positives = 45/54 (83%) Frame = +1 Query: 1 FVREELGAAYLTGEKARSPGEEFDKVLVAMNRGLLIDPLLECLKEWNGAPIPIC 162 FVREELG + LTGEK +SPGEEFDK A+ G LIDPLLECLKEWNGAP+PIC Sbjct: 27 FVREELGTSLLTGEKVKSPGEEFDKXFTAICAGKLIDPLLECLKEWNGAPLPIC 80