BLASTX nr result
ID: Cheilocostus21_contig00008342
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00008342 (915 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009409138.1| PREDICTED: uncharacterized protein LOC103991... 56 1e-06 >ref|XP_009409138.1| PREDICTED: uncharacterized protein LOC103991411 [Musa acuminata subsp. malaccensis] Length = 78 Score = 55.8 bits (133), Expect = 1e-06 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -3 Query: 391 LPKPEKGLWEGREMMEMTMDYKEPGANTNPRSGL 290 L + E GLW GR+M E MDYKEPGANTNPRSG+ Sbjct: 34 LSETENGLWTGRDMEETVMDYKEPGANTNPRSGV 67