BLASTX nr result
ID: Cheilocostus21_contig00006922
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00006922 (691 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048... 79 4e-15 gb|PKA51656.1| hypothetical protein AXF42_Ash003023 [Apostasia s... 74 4e-14 gb|OAY84392.1| hypothetical protein ACMD2_02065 [Ananas comosus] 73 1e-13 gb|OAY66762.1| hypothetical protein ACMD2_26146 [Ananas comosus] 67 3e-11 ref|XP_011082769.1| uncharacterized protein LOC105165451 [Sesamu... 66 8e-11 gb|KZV30864.1| hypothetical protein F511_37097 [Dorcoceras hygro... 60 9e-09 gb|KMZ75227.1| hypothetical protein ZOSMA_117G00450 [Zostera mar... 60 1e-08 ref|XP_012848947.1| PREDICTED: uncharacterized protein LOC105968... 60 1e-08 ref|XP_022872603.1| uncharacterized protein LOC111391587 [Olea e... 59 2e-08 emb|CDP06022.1| unnamed protein product [Coffea canephora] 59 2e-08 gb|PIA24714.1| hypothetical protein AQUCO_73100002v1 [Aquilegia ... 59 4e-08 gb|PON98460.1| hypothetical protein TorRG33x02_056940 [Trema ori... 58 7e-08 gb|PON31625.1| hypothetical protein PanWU01x14_368410 [Parasponi... 58 7e-08 gb|PIM98178.1| hypothetical protein CDL12_29342 [Handroanthus im... 57 2e-07 gb|KDO46955.1| hypothetical protein CISIN_1g035333mg [Citrus sin... 55 7e-07 gb|PIN15955.1| hypothetical protein CDL12_11408 [Handroanthus im... 55 7e-07 gb|PAN32840.1| hypothetical protein PAHAL_E04395 [Panicum hallii] 55 7e-07 emb|CBI20182.3| unnamed protein product, partial [Vitis vinifera] 54 1e-06 ref|XP_004968580.1| eukaryotic translation initiation factor 3 s... 55 2e-06 dbj|GAY62690.1| hypothetical protein CUMW_219840 [Citrus unshiu]... 54 2e-06 >ref|XP_010925624.1| PREDICTED: uncharacterized protein LOC105048118 [Elaeis guineensis] Length = 138 Score = 79.3 bits (194), Expect = 4e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKAD 434 M SEEVGTKLVRFLYFVGAGVICTKGINLW+DYERKAA+ A+ Sbjct: 1 MVSEEVGTKLVRFLYFVGAGVICTKGINLWRDYERKAAMKTAE 43 >gb|PKA51656.1| hypothetical protein AXF42_Ash003023 [Apostasia shenzhenica] Length = 60 Score = 74.3 bits (181), Expect = 4e-14 Identities = 35/50 (70%), Positives = 42/50 (84%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMA 413 M SEEVG KL+RFLYFVGAGVICTKGINLW+++E KAA+ A+ + QK A Sbjct: 1 MVSEEVGNKLLRFLYFVGAGVICTKGINLWREHEHKAALNSAEGSPQKPA 50 >gb|OAY84392.1| hypothetical protein ACMD2_02065 [Ananas comosus] Length = 66 Score = 73.2 bits (178), Expect = 1e-13 Identities = 35/56 (62%), Positives = 40/56 (71%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMAHTPVEM 395 MA +EVG KLVRFLYFVGAGVICTK INLW+DYERK + A + TP E+ Sbjct: 1 MAGDEVGVKLVRFLYFVGAGVICTKAINLWRDYERKQEIAAAAAEMGESPPTPQEL 56 >gb|OAY66762.1| hypothetical protein ACMD2_26146 [Ananas comosus] Length = 79 Score = 67.4 bits (163), Expect = 3e-11 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYER 458 MA +EVG KLVRFLYFVGAGVICTK INLW+DYER Sbjct: 1 MAGDEVGVKLVRFLYFVGAGVICTKAINLWRDYER 35 >ref|XP_011082769.1| uncharacterized protein LOC105165451 [Sesamum indicum] Length = 66 Score = 65.9 bits (159), Expect = 8e-11 Identities = 31/55 (56%), Positives = 36/55 (65%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMAHTPVEM 395 A EEV KLVR LYFVGAGV+CT GIN W+D ERKA + K Q N P ++ Sbjct: 6 AGEEVAPKLVRLLYFVGAGVLCTAGINKWKDLERKAMIQKQQQLNGPSVENPSDV 60 >gb|KZV30864.1| hypothetical protein F511_37097 [Dorcoceras hygrometricum] Length = 66 Score = 60.5 bits (145), Expect = 9e-09 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -1 Query: 553 EEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 EEVG KLVR LYFVGAGV+C GIN W+D ERK+ + K N Sbjct: 8 EEVGPKLVRLLYFVGAGVLCAAGINKWKDLERKSMIQKQQNVN 50 >gb|KMZ75227.1| hypothetical protein ZOSMA_117G00450 [Zostera marina] Length = 55 Score = 60.1 bits (144), Expect = 1e-08 Identities = 26/42 (61%), Positives = 34/42 (80%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKA 437 M +++VG+KLVRF+YFVGAG ICT IN W++ E KAA+ KA Sbjct: 1 MPNQQVGSKLVRFIYFVGAGFICTAAINKWRELENKAAIKKA 42 >ref|XP_012848947.1| PREDICTED: uncharacterized protein LOC105968817 [Erythranthe guttata] gb|EYU45031.1| hypothetical protein MIMGU_mgv1a017619mg [Erythranthe guttata] Length = 62 Score = 60.1 bits (144), Expect = 1e-08 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQ 431 A EEV KLVR LYFVGAGVICT IN W++ ERKA + K +Q Sbjct: 6 AGEEVAPKLVRLLYFVGAGVICTAAINKWKELERKALIQKEEQ 48 >ref|XP_022872603.1| uncharacterized protein LOC111391587 [Olea europaea var. sylvestris] Length = 66 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -1 Query: 553 EEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 EEVG KL R LYFVGAG +CT IN W+D+ERK+ + K Q N Sbjct: 8 EEVGPKLARLLYFVGAGFLCTAAINKWRDWERKSTIQKQQQFN 50 >emb|CDP06022.1| unnamed protein product [Coffea canephora] Length = 67 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -1 Query: 553 EEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVK 440 EEVG KLVRFLYF+GAG +CT IN W+D ERKA + K Sbjct: 9 EEVGPKLVRFLYFIGAGFVCTAAINKWRDLERKANIQK 46 >gb|PIA24714.1| hypothetical protein AQUCO_73100002v1 [Aquilegia coerulea] Length = 64 Score = 58.5 bits (140), Expect = 4e-08 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAA 449 M EE G KLVR L+FVGAGVI T INLW+DYERK+A Sbjct: 1 MPGEEAGAKLVRLLWFVGAGVITTTSINLWRDYERKSA 38 >gb|PON98460.1| hypothetical protein TorRG33x02_056940 [Trema orientalis] Length = 52 Score = 57.8 bits (138), Expect = 7e-08 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -1 Query: 544 GTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMAHTP 404 G KLVR LYFVGAG IC GIN W+DY+RK+ V++ D Q+ P Sbjct: 6 GPKLVRLLYFVGAGFICAIGINKWRDYQRKSMVIQQDPKLQQQQKQP 52 >gb|PON31625.1| hypothetical protein PanWU01x14_368410 [Parasponia andersonii] Length = 57 Score = 57.8 bits (138), Expect = 7e-08 Identities = 26/47 (55%), Positives = 32/47 (68%) Frame = -1 Query: 544 GTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMAHTP 404 G KLVR LYFVGAG IC GIN W+DY+RK+ V++ D Q+ P Sbjct: 11 GPKLVRLLYFVGAGFICAIGINKWRDYQRKSMVIQQDPKLQQQQKQP 57 >gb|PIM98178.1| hypothetical protein CDL12_29342 [Handroanthus impetiginosus] Length = 57 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/45 (55%), Positives = 31/45 (68%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 A E + TKLVR LYFVGAG +C GIN W++ ERK+ + K Q N Sbjct: 6 AGEVIRTKLVRLLYFVGAGAVCAVGINKWKEIERKSMIQKQQQLN 50 >gb|KDO46955.1| hypothetical protein CISIN_1g035333mg [Citrus sinensis] Length = 67 Score = 55.5 bits (132), Expect = 7e-07 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 MAS GTK++RFLYFVGAG ICT IN W++ ERK+ K +++ Sbjct: 6 MASGPAGTKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQQESD 51 >gb|PIN15955.1| hypothetical protein CDL12_11408 [Handroanthus impetiginosus] Length = 57 Score = 55.1 bits (131), Expect = 7e-07 Identities = 24/45 (53%), Positives = 30/45 (66%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 A E + TKLVR LYFVG G +C GIN W++ ERK+ + K Q N Sbjct: 6 AGEVIRTKLVRLLYFVGTGAVCAVGINKWKEIERKSMIQKQQQLN 50 >gb|PAN32840.1| hypothetical protein PAHAL_E04395 [Panicum hallii] Length = 71 Score = 55.5 bits (132), Expect = 7e-07 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 3/55 (5%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERK---AAVVKADQTNQKMAHTP 404 A+ E +KL+RFLYFVGAGVICTK IN ++DYE K +A V A ++ A P Sbjct: 3 AAGEASSKLLRFLYFVGAGVICTKAINTYRDYEHKKEASAAVSAAESALDSAAAP 57 >emb|CBI20182.3| unnamed protein product, partial [Vitis vinifera] Length = 58 Score = 54.3 bits (129), Expect = 1e-06 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = -1 Query: 544 GTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTNQKMAH 410 G K++R LYFVGAG ICT IN W+D +RK+A ADQ +K A+ Sbjct: 10 GPKVLRMLYFVGAGFICTAAINKWRDLQRKSAQQHADQLPEKPAN 54 >ref|XP_004968580.1| eukaryotic translation initiation factor 3 subunit D [Setaria italica] Length = 75 Score = 54.7 bits (130), Expect = 2e-06 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 4/53 (7%) Frame = -1 Query: 559 ASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERK----AAVVKADQTNQKMA 413 A+ E +KL+RFLYFVGAGVICTK IN ++DYE K AAV A +A Sbjct: 3 AAGEASSKLLRFLYFVGAGVICTKAINTYRDYEHKKEASAAVAAAAAAEAALA 55 >dbj|GAY62690.1| hypothetical protein CUMW_219840 [Citrus unshiu] dbj|GAY62691.1| hypothetical protein CUMW_219840 [Citrus unshiu] Length = 67 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/46 (52%), Positives = 33/46 (71%) Frame = -1 Query: 562 MASEEVGTKLVRFLYFVGAGVICTKGINLWQDYERKAAVVKADQTN 425 MA+ GTK++RFLYFVGAG ICT IN W++ ERK+ K +++ Sbjct: 6 MAAGPAGTKVLRFLYFVGAGFICTAAINKWRELERKSLQKKQQESD 51