BLASTX nr result
ID: Cheilocostus21_contig00006648
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00006648 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020090886.1| uncharacterized protein LOC109711924 [Ananas... 56 2e-07 >ref|XP_020090886.1| uncharacterized protein LOC109711924 [Ananas comosus] gb|OAY79204.1| hypothetical protein ACMD2_00059 [Ananas comosus] Length = 105 Score = 56.2 bits (134), Expect = 2e-07 Identities = 28/42 (66%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = +3 Query: 84 RIKYSTEHPDDA--GGVVEKARSTAEEFLRQAKEKSDSISDS 203 R++YSTEH +D+ G V KARSTAEEFLRQAKEK D +S+S Sbjct: 25 RLRYSTEHKEDSRVGEVAHKARSTAEEFLRQAKEKKDEMSES 66