BLASTX nr result
ID: Cheilocostus21_contig00006589
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00006589 (479 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389652.1| PREDICTED: A-kinase anchor protein 17A [Musa... 61 7e-08 >ref|XP_009389652.1| PREDICTED: A-kinase anchor protein 17A [Musa acuminata subsp. malaccensis] Length = 348 Score = 60.8 bits (146), Expect = 7e-08 Identities = 31/48 (64%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = +2 Query: 2 HQKASR-YHSERDNTTQVSAGYIRNESKIDEPHNTFDSSGSRRKRFRE 142 +QK R Y ERD++TQV AG IRNE ++PH TFDS+GSRRKRFRE Sbjct: 301 NQKPYRSYRQERDSSTQVMAGNIRNEPSKNQPHITFDSNGSRRKRFRE 348