BLASTX nr result
ID: Cheilocostus21_contig00005762
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00005762 (483 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009389858.1| PREDICTED: NAC domain-containing protein 79-... 74 2e-13 ref|XP_009389859.1| PREDICTED: uncharacterized protein LOC103976... 59 3e-08 >ref|XP_009389858.1| PREDICTED: NAC domain-containing protein 79-like [Musa acuminata subsp. malaccensis] Length = 181 Score = 73.9 bits (180), Expect = 2e-13 Identities = 44/97 (45%), Positives = 54/97 (55%), Gaps = 3/97 (3%) Frame = +3 Query: 30 KITDQPLLPPKSFFIPELHVDGQPPWELFRIASGSRYIPDGTFCCFVRVNRSLAGDRRLK 209 K+ + PL P F IPE+ V + PWEL +S Y+P G CFV V RS A D RL Sbjct: 36 KVRNLPLRIPPGFSIPEMEVYKKAPWELMVRSS---YLPTGVSYCFVHVPRSKASDNRLN 92 Query: 210 RKTRGGTWVANGTPA*GGRRD---SHRSQVLQGRRRA 311 RKT GG+WVANG P RD +R + G RR+ Sbjct: 93 RKTLGGSWVANGKP-----RDIPLRYRGSAITGIRRS 124 >ref|XP_009389859.1| PREDICTED: uncharacterized protein LOC103976392 [Musa acuminata subsp. malaccensis] Length = 118 Score = 58.9 bits (141), Expect = 3e-08 Identities = 32/60 (53%), Positives = 37/60 (61%) Frame = +3 Query: 132 SRYIPDGTFCCFVRVNRSLAGDRRLKRKTRGGTWVANGTPA*GGRRDSHRSQVLQGRRRA 311 S Y+P G CFVRV RS A D RL RKT GG+WVANG P R +R V+ G RR+ Sbjct: 4 SSYLPTGVSYCFVRVPRSKASDNRLNRKTPGGSWVANGKPCDIPLR--YRGSVIAGIRRS 61