BLASTX nr result
ID: Cheilocostus21_contig00005740
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00005740 (641 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009395558.1| PREDICTED: transcription initiation factor I... 64 1e-08 ref|XP_020080917.1| general transcription factor IIE subunit 2-l... 59 6e-07 ref|XP_020080916.1| general transcription factor IIE subunit 2-l... 59 7e-07 ref|XP_008797624.1| PREDICTED: transcription initiation factor I... 58 2e-06 ref|XP_010936965.1| PREDICTED: transcription initiation factor I... 57 4e-06 ref|XP_019250201.1| PREDICTED: uncharacterized protein LOC109229... 56 1e-05 ref|XP_009791144.1| PREDICTED: uncharacterized protein LOC104238... 56 1e-05 >ref|XP_009395558.1| PREDICTED: transcription initiation factor IIE subunit beta [Musa acuminata subsp. malaccensis] ref|XP_009395559.1| PREDICTED: transcription initiation factor IIE subunit beta [Musa acuminata subsp. malaccensis] ref|XP_009395560.1| PREDICTED: transcription initiation factor IIE subunit beta [Musa acuminata subsp. malaccensis] ref|XP_018680840.1| PREDICTED: transcription initiation factor IIE subunit beta [Musa acuminata subsp. malaccensis] Length = 282 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = +1 Query: 541 MSLQESLNRFKQQQEKCQSTLTSIAARAAPSKA 639 MSLQESLNRFKQQQEKCQSTL+SIAARAAPSKA Sbjct: 1 MSLQESLNRFKQQQEKCQSTLSSIAARAAPSKA 33 >ref|XP_020080917.1| general transcription factor IIE subunit 2-like isoform X2 [Ananas comosus] ref|XP_020097125.1| general transcription factor IIE subunit 2-like isoform X2 [Ananas comosus] Length = 286 Score = 59.3 bits (142), Expect = 6e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 541 MSLQESLNRFKQQQEKCQSTLTSIAARAAPSKA 639 M+LQESLN+FKQQQEKCQSTLTSIAAR+A SKA Sbjct: 1 MALQESLNKFKQQQEKCQSTLTSIAARSASSKA 33 >ref|XP_020080916.1| general transcription factor IIE subunit 2-like isoform X1 [Ananas comosus] ref|XP_020097116.1| general transcription factor IIE subunit 2-like isoform X1 [Ananas comosus] Length = 302 Score = 59.3 bits (142), Expect = 7e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = +1 Query: 541 MSLQESLNRFKQQQEKCQSTLTSIAARAAPSKA 639 M+LQESLN+FKQQQEKCQSTLTSIAAR+A SKA Sbjct: 17 MALQESLNKFKQQQEKCQSTLTSIAARSASSKA 49 >ref|XP_008797624.1| PREDICTED: transcription initiation factor IIE subunit beta [Phoenix dactylifera] Length = 287 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = +1 Query: 541 MSLQESLNRFKQQQEKCQSTLTSIAARAAPSK 636 MSLQESLN+FKQQQEKCQSTLTSIAARA SK Sbjct: 1 MSLQESLNKFKQQQEKCQSTLTSIAARAQSSK 32 >ref|XP_010936965.1| PREDICTED: transcription initiation factor IIE subunit beta [Elaeis guineensis] Length = 284 Score = 57.0 bits (136), Expect = 4e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 541 MSLQESLNRFKQQQEKCQSTLTSIAARAAPSK 636 MSLQESLN+FKQQQEKCQSTLT+IAARA SK Sbjct: 1 MSLQESLNKFKQQQEKCQSTLTNIAARAQSSK 32 >ref|XP_019250201.1| PREDICTED: uncharacterized protein LOC109229270 [Nicotiana attenuata] gb|OIT00849.1| hypothetical protein A4A49_21092 [Nicotiana attenuata] Length = 276 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 544 SLQESLNRFKQQQEKCQSTLTSIAARAAPSKA 639 SLQESL RFK+QQEKCQSTL+SIA+RA PSKA Sbjct: 3 SLQESLQRFKKQQEKCQSTLSSIASRAGPSKA 34 >ref|XP_009791144.1| PREDICTED: uncharacterized protein LOC104238483 [Nicotiana sylvestris] ref|XP_016487421.1| PREDICTED: uncharacterized protein LOC107807528 [Nicotiana tabacum] Length = 276 Score = 55.8 bits (133), Expect = 1e-05 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 544 SLQESLNRFKQQQEKCQSTLTSIAARAAPSKA 639 SLQESL RFK+QQEKCQSTL+SIA+RA PSKA Sbjct: 3 SLQESLQRFKKQQEKCQSTLSSIASRAGPSKA 34