BLASTX nr result
ID: Cheilocostus21_contig00005710
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00005710 (696 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-co... 99 2e-22 gb|ARU09637.1| stress associated protein [Musa AAB Group] 98 6e-22 ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-co... 98 6e-22 gb|ACL01101.1| zinc finger protein [Phyllostachys edulis] 94 2e-20 gb|ADF80942.1| zinc finger protein [Phyllostachys praecox] 94 2e-20 gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-... 91 3e-20 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 91 3e-20 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 91 3e-20 gb|ADF80943.1| zinc finger protein [Phyllostachys vivax] 93 4e-20 gb|OEL16871.1| Zinc finger A20 and AN1 domain-containing stress-... 93 7e-20 ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-co... 92 7e-20 ref|XP_015695656.1| PREDICTED: zinc finger A20 and AN1 domain-co... 91 8e-20 ref|XP_019186659.1| PREDICTED: zinc finger A20 and AN1 domain-co... 93 8e-20 ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-co... 93 8e-20 ref|XP_020197560.1| zinc finger A20 and AN1 domain-containing st... 92 9e-20 ref|XP_022983489.1| zinc finger A20 and AN1 domain-containing st... 92 1e-19 ref|XP_022935503.1| zinc finger A20 and AN1 domain-containing st... 92 1e-19 ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-co... 92 1e-19 ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-co... 92 1e-19 gb|PPS04468.1| hypothetical protein GOBAR_AA16189 [Gossypium bar... 91 1e-19 >ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Musa acuminata subsp. malaccensis] Length = 155 Score = 99.0 bits (245), Expect = 2e-22 Identities = 45/77 (58%), Positives = 52/77 (67%) Frame = +1 Query: 1 PQIRSPEPSELAKDVEGXXXXXXXXXXXXXXXXXQVNRCFSCRKRVGLTGFRCRCGELFC 180 P IRSP+P++ A++ +VNRC SCRKRVG TGFRCRCGELFC Sbjct: 61 PSIRSPDPADRAEE---QGAPTAALASPAPAPARKVNRCLSCRKRVGFTGFRCRCGELFC 117 Query: 181 GEHRYSDRHECSYDYKA 231 GEHRYSDRH+C YDYKA Sbjct: 118 GEHRYSDRHDCGYDYKA 134 >gb|ARU09637.1| stress associated protein [Musa AAB Group] Length = 155 Score = 97.8 bits (242), Expect = 6e-22 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QV+RCFSCRKRVGLTGFRCRCG+LFCGEHRYSDRH+CSYDYKA Sbjct: 92 QVSRCFSCRKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKA 134 >ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 11-like [Musa acuminata subsp. malaccensis] Length = 155 Score = 97.8 bits (242), Expect = 6e-22 Identities = 40/43 (93%), Positives = 43/43 (100%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QV+RCFSCRKRVGLTGFRCRCG+LFCGEHRYSDRH+CSYDYKA Sbjct: 92 QVSRCFSCRKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKA 134 >gb|ACL01101.1| zinc finger protein [Phyllostachys edulis] Length = 164 Score = 94.4 bits (233), Expect = 2e-20 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC SCRKRVGLTGFRCRCGELFCGEHRYSDRH CSYDYKA Sbjct: 102 VNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKA 143 >gb|ADF80942.1| zinc finger protein [Phyllostachys praecox] Length = 165 Score = 94.4 bits (233), Expect = 2e-20 Identities = 40/42 (95%), Positives = 40/42 (95%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC SCRKRVGLTGFRCRCGELFCGEHRYSDRH CSYDYKA Sbjct: 103 VNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKA 144 >gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum annuum] Length = 86 Score = 91.3 bits (225), Expect = 3e-20 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYK 228 +VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH+CSYDYK Sbjct: 25 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 66 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 91.3 bits (225), Expect = 3e-20 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYK 228 +VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH+CSYDYK Sbjct: 24 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 65 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 91.3 bits (225), Expect = 3e-20 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYK 228 +VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH+CSYDYK Sbjct: 25 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 66 >gb|ADF80943.1| zinc finger protein [Phyllostachys vivax] Length = 163 Score = 93.2 bits (230), Expect = 4e-20 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC SCRKR+GLTGFRCRCGELFCGEHRYSDRH CSYDYKA Sbjct: 101 VNRCSSCRKRLGLTGFRCRCGELFCGEHRYSDRHGCSYDYKA 142 >gb|OEL16871.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Dichanthelium oligosanthes] Length = 168 Score = 92.8 bits (229), Expect = 7e-20 Identities = 42/71 (59%), Positives = 44/71 (61%) Frame = +1 Query: 16 PEPSELAKDVEGXXXXXXXXXXXXXXXXXQVNRCFSCRKRVGLTGFRCRCGELFCGEHRY 195 P P ELA + VNRC SCRKRVGLTGFRCRCGELFCG HRY Sbjct: 76 PPPMELASPADAAVDLPALAAPAPAAARTSVNRCSSCRKRVGLTGFRCRCGELFCGAHRY 135 Query: 196 SDRHECSYDYK 228 SDRH CSYDY+ Sbjct: 136 SDRHGCSYDYR 146 >ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 11-like [Elaeis guineensis] Length = 158 Score = 92.4 bits (228), Expect = 7e-20 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH+CS+DYKA Sbjct: 95 QVNRCAGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKA 137 >ref|XP_015695656.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 11-like [Oryza brachyantha] Length = 121 Score = 91.3 bits (225), Expect = 8e-20 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC SCRKRVGLTGFRCRCGELFCG HRYSDRH+CS+DYK+ Sbjct: 59 VNRCHSCRKRVGLTGFRCRCGELFCGAHRYSDRHDCSFDYKS 100 >ref|XP_019186659.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 174 Score = 92.8 bits (229), Expect = 8e-20 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 +VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH+CSYDYKA Sbjct: 111 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKA 153 >ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 176 Score = 92.8 bits (229), Expect = 8e-20 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 +VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH+CSYDYKA Sbjct: 113 EVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKA 155 >ref|XP_020197560.1| zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Aegilops tauschii subsp. tauschii] Length = 165 Score = 92.4 bits (228), Expect = 9e-20 Identities = 38/42 (90%), Positives = 40/42 (95%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC SCRKRVGLTGFRCRCG++FCGEHRYSDRH CSYDYKA Sbjct: 103 VNRCSSCRKRVGLTGFRCRCGDMFCGEHRYSDRHGCSYDYKA 144 >ref|XP_022983489.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita maxima] Length = 169 Score = 92.4 bits (228), Expect = 1e-19 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH+CS+DYKA Sbjct: 106 QVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKA 148 >ref|XP_022935503.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita moschata] Length = 169 Score = 92.4 bits (228), Expect = 1e-19 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH+CS+DYKA Sbjct: 106 QVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKA 148 >ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis melo] Length = 169 Score = 92.4 bits (228), Expect = 1e-19 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH+CS+DYKA Sbjct: 106 QVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKA 148 >ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus] Length = 169 Score = 92.4 bits (228), Expect = 1e-19 Identities = 38/43 (88%), Positives = 40/43 (93%) Frame = +1 Query: 103 QVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 QVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH+CS+DYKA Sbjct: 106 QVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKA 148 >gb|PPS04468.1| hypothetical protein GOBAR_AA16189 [Gossypium barbadense] Length = 119 Score = 90.9 bits (224), Expect = 1e-19 Identities = 37/42 (88%), Positives = 39/42 (92%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHECSYDYKA 231 VNRC CRKRVGLTGFRCRCGELFC +HRYSDRH+CSYDYKA Sbjct: 57 VNRCSGCRKRVGLTGFRCRCGELFCSDHRYSDRHDCSYDYKA 98