BLASTX nr result
ID: Cheilocostus21_contig00005690
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00005690 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloproteas... 91 7e-18 ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloproteas... 90 2e-17 ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloproteas... 90 2e-17 ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloproteas... 89 3e-17 gb|ONK64141.1| uncharacterized protein A4U43_C07F22510 [Asparagu... 86 6e-17 ref|XP_020274660.1| LOW QUALITY PROTEIN: ATP-dependent zinc meta... 86 4e-16 gb|PKA66356.1| ATP-dependent zinc metalloprotease FTSH, chloropl... 83 5e-15 gb|KMZ58892.1| ATP-dependent zinc metalloprotease FtsH 2 [Zoster... 81 2e-14 ref|XP_006828956.1| ATP-dependent zinc metalloprotease FTSH 1, c... 81 2e-14 ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloproteas... 81 3e-14 gb|PIA46934.1| hypothetical protein AQUCO_01500455v1 [Aquilegia ... 80 4e-14 gb|PIA46931.1| hypothetical protein AQUCO_01500455v1 [Aquilegia ... 80 4e-14 gb|PIA46932.1| hypothetical protein AQUCO_01500455v1 [Aquilegia ... 80 4e-14 gb|PIA46933.1| hypothetical protein AQUCO_01500455v1 [Aquilegia ... 80 4e-14 gb|KQL12294.1| hypothetical protein SETIT_005992mg [Setaria ital... 79 8e-14 gb|PNT38612.1| hypothetical protein POPTR_005G249200v3 [Populus ... 79 9e-14 gb|PNT38611.1| hypothetical protein POPTR_005G249200v3 [Populus ... 79 9e-14 gb|KQL12296.1| hypothetical protein SETIT_005992mg [Setaria ital... 79 9e-14 gb|PNT38614.1| hypothetical protein POPTR_005G249200v3 [Populus ... 79 9e-14 ref|XP_004966506.1| ATP-dependent zinc metalloprotease FTSH 1, c... 79 9e-14 >ref|XP_010941398.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Elaeis guineensis] Length = 723 Score = 91.3 bits (225), Expect = 7e-18 Identities = 41/48 (85%), Positives = 47/48 (97%) Frame = +2 Query: 437 PSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 PS+PF+QS+LTAP+PQSSPDLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 116 PSSPFSQSLLTAPKPQSSPDLPEGSQWRYSEFLNAVKKGKVERVRFSK 163 >ref|XP_008812082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like [Phoenix dactylifera] Length = 724 Score = 90.1 bits (222), Expect = 2e-17 Identities = 40/48 (83%), Positives = 47/48 (97%) Frame = +2 Query: 437 PSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 PS+PF+QS+LTAP+PQ+SPDLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 117 PSSPFSQSLLTAPKPQTSPDLPEGSQWRYSEFLNAVKKGKVERVRFSK 164 >ref|XP_009395377.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Musa acuminata subsp. malaccensis] Length = 706 Score = 89.7 bits (221), Expect = 2e-17 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +2 Query: 434 KPSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 KP NPFAQS+LTAPRPQ+S DLP+GSQWRYSEFL+AVK+G VERVRFSK Sbjct: 98 KPDNPFAQSLLTAPRPQTSSDLPEGSQWRYSEFLDAVKKGKVERVRFSK 146 >ref|XP_009418681.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like [Musa acuminata subsp. malaccensis] Length = 715 Score = 89.4 bits (220), Expect = 3e-17 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 SNPF+QS+LTAPRPQ+SPDL DGSQWRYSEFLNAVKRG VERVRFSK Sbjct: 109 SNPFSQSLLTAPRPQASPDLLDGSQWRYSEFLNAVKRGKVERVRFSK 155 >gb|ONK64141.1| uncharacterized protein A4U43_C07F22510 [Asparagus officinalis] Length = 267 Score = 86.3 bits (212), Expect = 6e-17 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 437 PSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 PSNPF+QS+LTAP PQ + DLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 191 PSNPFSQSLLTAPTPQQASDLPEGSQWRYSEFLNAVKKGKVERVRFSK 238 Score = 84.3 bits (207), Expect = 3e-16 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 437 PSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFS 577 PSNPF+QS+LTAP PQ + DLP+GSQWRYSEFLNAVK+G VERVRFS Sbjct: 98 PSNPFSQSLLTAPTPQQASDLPEGSQWRYSEFLNAVKKGKVERVRFS 144 >ref|XP_020274660.1| LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease FTSH 1, chloroplastic-like [Asparagus officinalis] Length = 711 Score = 86.3 bits (212), Expect = 4e-16 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +2 Query: 437 PSNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 PSNPF+QS+LTAP PQ + DLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 98 PSNPFSQSLLTAPTPQQASDLPEGSQWRYSEFLNAVKKGKVERVRFSK 145 >gb|PKA66356.1| ATP-dependent zinc metalloprotease FTSH, chloroplastic [Apostasia shenzhenica] Length = 471 Score = 82.8 bits (203), Expect = 5e-15 Identities = 40/49 (81%), Positives = 45/49 (91%), Gaps = 2/49 (4%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSS--PDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 SNPF+QS+LTAP+PQS+ DLPDGSQWRYSEFLNAVK+G VERVRFSK Sbjct: 124 SNPFSQSLLTAPKPQSTIASDLPDGSQWRYSEFLNAVKKGKVERVRFSK 172 >gb|KMZ58892.1| ATP-dependent zinc metalloprotease FtsH 2 [Zostera marina] Length = 713 Score = 81.3 bits (199), Expect = 2e-14 Identities = 39/48 (81%), Positives = 44/48 (91%), Gaps = 1/48 (2%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQ-SSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 +NPFAQ+ LTAP+PQ SS D+PDGSQWRYSEFLNAVK+G VERVRFSK Sbjct: 102 ANPFAQNSLTAPKPQQSSADIPDGSQWRYSEFLNAVKKGKVERVRFSK 149 >ref|XP_006828956.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Amborella trichopoda] gb|ERM96372.1| hypothetical protein AMTR_s00001p00232760 [Amborella trichopoda] Length = 713 Score = 81.3 bits (199), Expect = 2e-14 Identities = 38/48 (79%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSS-PDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 ++PFA S+L+AP+PQSS PD+PDGSQWRYSEFLNAVK+G VERVRFSK Sbjct: 107 ASPFANSLLSAPKPQSSSPDIPDGSQWRYSEFLNAVKKGKVERVRFSK 154 >ref|XP_004500893.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH, chloroplastic [Cicer arietinum] Length = 713 Score = 80.9 bits (198), Expect = 3e-14 Identities = 38/48 (79%), Positives = 45/48 (93%), Gaps = 1/48 (2%) Frame = +2 Query: 440 SNPFAQSV-LTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 S+PF+Q++ LTAP+PQSS DLPDG+QWRYSEFLNAVK+G VERVRFSK Sbjct: 107 SSPFSQNISLTAPKPQSSSDLPDGNQWRYSEFLNAVKKGKVERVRFSK 154 >gb|PIA46934.1| hypothetical protein AQUCO_01500455v1 [Aquilegia coerulea] Length = 611 Score = 80.5 bits (197), Expect = 4e-14 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +2 Query: 434 KPSNPFAQSV-LTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 K S+PF+Q++ LTAP+PQ+S DLPDG+QWRYSEFLNAVK+G VERVRFSK Sbjct: 103 KSSSPFSQNLNLTAPKPQTSSDLPDGNQWRYSEFLNAVKKGKVERVRFSK 152 >gb|PIA46931.1| hypothetical protein AQUCO_01500455v1 [Aquilegia coerulea] Length = 664 Score = 80.5 bits (197), Expect = 4e-14 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +2 Query: 434 KPSNPFAQSV-LTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 K S+PF+Q++ LTAP+PQ+S DLPDG+QWRYSEFLNAVK+G VERVRFSK Sbjct: 103 KSSSPFSQNLNLTAPKPQTSSDLPDGNQWRYSEFLNAVKKGKVERVRFSK 152 >gb|PIA46932.1| hypothetical protein AQUCO_01500455v1 [Aquilegia coerulea] Length = 695 Score = 80.5 bits (197), Expect = 4e-14 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +2 Query: 434 KPSNPFAQSV-LTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 K S+PF+Q++ LTAP+PQ+S DLPDG+QWRYSEFLNAVK+G VERVRFSK Sbjct: 103 KSSSPFSQNLNLTAPKPQTSSDLPDGNQWRYSEFLNAVKKGKVERVRFSK 152 >gb|PIA46933.1| hypothetical protein AQUCO_01500455v1 [Aquilegia coerulea] Length = 710 Score = 80.5 bits (197), Expect = 4e-14 Identities = 38/50 (76%), Positives = 46/50 (92%), Gaps = 1/50 (2%) Frame = +2 Query: 434 KPSNPFAQSV-LTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 K S+PF+Q++ LTAP+PQ+S DLPDG+QWRYSEFLNAVK+G VERVRFSK Sbjct: 103 KSSSPFSQNLNLTAPKPQTSSDLPDGNQWRYSEFLNAVKKGKVERVRFSK 152 >gb|KQL12294.1| hypothetical protein SETIT_005992mg [Setaria italica] Length = 499 Score = 79.3 bits (194), Expect = 8e-14 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 +NPFA S+LTAP+P ++ DLP+G+QWRYSEFL+AVKRG VERVRFSK Sbjct: 77 ANPFANSLLTAPKPSAAADLPEGAQWRYSEFLSAVKRGKVERVRFSK 123 >gb|PNT38612.1| hypothetical protein POPTR_005G249200v3 [Populus trichocarpa] Length = 522 Score = 79.3 bits (194), Expect = 9e-14 Identities = 40/52 (76%), Positives = 47/52 (90%), Gaps = 3/52 (5%) Frame = +2 Query: 434 KPSNPFAQSVL-TAPRPQS--SPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 KPS+PFAQ++L TAP+PQS + DLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 95 KPSSPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRFSK 146 >gb|PNT38611.1| hypothetical protein POPTR_005G249200v3 [Populus trichocarpa] gb|PNT38615.1| hypothetical protein POPTR_005G249200v3 [Populus trichocarpa] Length = 585 Score = 79.3 bits (194), Expect = 9e-14 Identities = 40/52 (76%), Positives = 47/52 (90%), Gaps = 3/52 (5%) Frame = +2 Query: 434 KPSNPFAQSVL-TAPRPQS--SPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 KPS+PFAQ++L TAP+PQS + DLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 95 KPSSPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRFSK 146 >gb|KQL12296.1| hypothetical protein SETIT_005992mg [Setaria italica] Length = 617 Score = 79.3 bits (194), Expect = 9e-14 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 +NPFA S+LTAP+P ++ DLP+G+QWRYSEFL+AVKRG VERVRFSK Sbjct: 77 ANPFANSLLTAPKPSAAADLPEGAQWRYSEFLSAVKRGKVERVRFSK 123 >gb|PNT38614.1| hypothetical protein POPTR_005G249200v3 [Populus trichocarpa] Length = 658 Score = 79.3 bits (194), Expect = 9e-14 Identities = 40/52 (76%), Positives = 47/52 (90%), Gaps = 3/52 (5%) Frame = +2 Query: 434 KPSNPFAQSVL-TAPRPQS--SPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 KPS+PFAQ++L TAP+PQS + DLP+GSQWRYSEFLNAVK+G VERVRFSK Sbjct: 95 KPSSPFAQNLLVTAPKPQSESTSDLPEGSQWRYSEFLNAVKKGKVERVRFSK 146 >ref|XP_004966506.1| ATP-dependent zinc metalloprotease FTSH 1, chloroplastic [Setaria italica] gb|KQL12295.1| hypothetical protein SETIT_005992mg [Setaria italica] Length = 685 Score = 79.3 bits (194), Expect = 9e-14 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = +2 Query: 440 SNPFAQSVLTAPRPQSSPDLPDGSQWRYSEFLNAVKRGTVERVRFSK 580 +NPFA S+LTAP+P ++ DLP+G+QWRYSEFL+AVKRG VERVRFSK Sbjct: 77 ANPFANSLLTAPKPSAAADLPEGAQWRYSEFLSAVKRGKVERVRFSK 123