BLASTX nr result
ID: Cheilocostus21_contig00004856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00004856 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416254.1| PREDICTED: histone H2B-like [Musa acuminata ... 97 6e-24 ref|XP_009388463.1| PREDICTED: histone H2B.3-like [Musa acuminat... 97 1e-23 ref|XP_009399875.1| PREDICTED: histone H2B-like [Musa acuminata ... 97 1e-23 ref|XP_009406979.1| PREDICTED: histone H2B [Musa acuminata subsp... 96 2e-23 ref|XP_009414311.1| PREDICTED: histone H2B-like [Musa acuminata ... 96 2e-23 ref|XP_020086409.1| probable histone H2B.1 [Ananas comosus] >gi|... 94 5e-23 gb|PKA51922.1| Histone H2B.6 [Apostasia shenzhenica] 94 5e-23 ref|XP_020577755.1| histone H2B.4-like [Phalaenopsis equestris] 94 5e-23 ref|XP_020086412.1| probable histone H2B.1 [Ananas comosus] 94 5e-23 ref|XP_020571758.1| histone H2B.11 [Phalaenopsis equestris] 94 5e-23 ref|XP_020693123.1| histone H2B.4 [Dendrobium catenatum] >gi|131... 94 5e-23 ref|XP_020693139.1| histone H2B.1-like [Dendrobium catenatum] >g... 94 5e-23 ref|XP_017645522.1| PREDICTED: LOW QUALITY PROTEIN: histone H2B.... 94 6e-23 ref|XP_020101246.1| histone H2B.4-like [Ananas comosus] 94 6e-23 ref|XP_022752776.1| histone H2B-like [Durio zibethinus] 94 6e-23 ref|XP_020108524.1| histone H2B.11-like [Ananas comosus] 94 6e-23 ref|XP_020108522.1| histone H2B.11-like [Ananas comosus] >gi|103... 94 6e-23 gb|OAY68487.1| Histone H2B.6 [Ananas comosus] 94 6e-23 gb|OAY84720.1| Histone H2B [Ananas comosus] 94 6e-23 gb|PKA51928.1| Histone H2B.6 [Apostasia shenzhenica] 94 6e-23 >ref|XP_009416254.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis] Length = 158 Score = 97.4 bits (241), Expect(2) = 6e-24 Identities = 52/73 (71%), Positives = 53/73 (72%) Frame = +3 Query: 36 GKRLPXXXXXXXXXXXXXXXXXXXXTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 215 GKR+P TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND Sbjct: 43 GKRIPSSKDGAGSAGDKKRRKAKKGTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 102 Query: 216 IFEKLAQEASRLA 254 IFEKLAQEASRLA Sbjct: 103 IFEKLAQEASRLA 115 Score = 41.6 bits (96), Expect(2) = 6e-24 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 139 ELAKHAVSEGTKAVTKFTSS 158 >ref|XP_009388463.1| PREDICTED: histone H2B.3-like [Musa acuminata subsp. malaccensis] Length = 160 Score = 96.7 bits (239), Expect(2) = 1e-23 Identities = 52/73 (71%), Positives = 53/73 (72%) Frame = +3 Query: 36 GKRLPXXXXXXXXXXXXXXXXXXXXTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 215 GKRLP +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND Sbjct: 45 GKRLPSKEGVGAGGIDKKKKKAKKGSETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 104 Query: 216 IFEKLAQEASRLA 254 IFEKLAQEASRLA Sbjct: 105 IFEKLAQEASRLA 117 Score = 41.6 bits (96), Expect(2) = 1e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 141 ELAKHAVSEGTKAVTKFTSS 160 >ref|XP_009399875.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis] Length = 154 Score = 96.7 bits (239), Expect(2) = 1e-23 Identities = 52/73 (71%), Positives = 53/73 (72%) Frame = +3 Query: 36 GKRLPXXXXXXXXXXXXXXXXXXXXTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 215 GKRLP +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND Sbjct: 39 GKRLPSKDGGAVSTGEKKKKKAKKGSETYKIYIFKVLKQVHPDIGISSKAMSIMNSFIND 98 Query: 216 IFEKLAQEASRLA 254 IFEKLAQEASRLA Sbjct: 99 IFEKLAQEASRLA 111 Score = 41.6 bits (96), Expect(2) = 1e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 135 ELAKHAVSEGTKAVTKFTSS 154 >ref|XP_009406979.1| PREDICTED: histone H2B [Musa acuminata subsp. malaccensis] Length = 156 Score = 95.5 bits (236), Expect(2) = 2e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 66 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 113 Score = 41.6 bits (96), Expect(2) = 2e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 137 ELAKHAVSEGTKAVTKFTSS 156 >ref|XP_009414311.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis] Length = 151 Score = 95.5 bits (236), Expect(2) = 2e-23 Identities = 48/48 (100%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 61 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 108 Score = 41.6 bits (96), Expect(2) = 2e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 132 ELAKHAVSEGTKAVTKFTSS 151 >ref|XP_020086409.1| probable histone H2B.1 [Ananas comosus] gb|OAY72151.1| putative histone H2B.1 [Ananas comosus] Length = 164 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 74 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 121 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 145 ELAKHAVSEGTKAVTKFTSS 164 >gb|PKA51922.1| Histone H2B.6 [Apostasia shenzhenica] Length = 160 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 51/72 (70%), Positives = 52/72 (72%) Frame = +3 Query: 39 KRLPXXXXXXXXXXXXXXXXXXXXTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDI 218 KRLP +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDI Sbjct: 46 KRLPASKEGGSAGDKKKKKKAKKGSETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDI 105 Query: 219 FEKLAQEASRLA 254 FEKLAQEASRLA Sbjct: 106 FEKLAQEASRLA 117 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 141 ELAKHAVSEGTKAVTKFTSS 160 >ref|XP_020577755.1| histone H2B.4-like [Phalaenopsis equestris] Length = 158 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 68 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 115 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 139 ELAKHAVSEGTKAVTKFTSS 158 >ref|XP_020086412.1| probable histone H2B.1 [Ananas comosus] Length = 158 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 68 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 115 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 139 ELAKHAVSEGTKAVTKFTSS 158 >ref|XP_020571758.1| histone H2B.11 [Phalaenopsis equestris] Length = 154 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 64 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 111 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 135 ELAKHAVSEGTKAVTKFTSS 154 >ref|XP_020693123.1| histone H2B.4 [Dendrobium catenatum] gb|PKU87630.1| Histone H2B.1 [Dendrobium catenatum] Length = 152 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 62 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 109 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 133 ELAKHAVSEGTKAVTKFTSS 152 >ref|XP_020693139.1| histone H2B.1-like [Dendrobium catenatum] gb|PKU87641.1| Histone H2B.6 [Dendrobium catenatum] Length = 151 Score = 94.4 bits (233), Expect(2) = 5e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQE+SRLA Sbjct: 61 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQESSRLA 108 Score = 41.6 bits (96), Expect(2) = 5e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 132 ELAKHAVSEGTKAVTKFTSS 151 >ref|XP_017645522.1| PREDICTED: LOW QUALITY PROTEIN: histone H2B.v1 [Gossypium arboreum] Length = 296 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQEASRLA Sbjct: 57 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA 104 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 128 ELAKHAVSEGTKAVTKFTSS 147 Score = 92.0 bits (227), Expect(2) = 2e-22 Identities = 46/47 (97%), Positives = 46/47 (97%) Frame = +3 Query: 114 ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 ETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQEASRLA Sbjct: 207 ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA 253 Score = 41.6 bits (96), Expect(2) = 2e-22 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 277 ELAKHAVSEGTKAVTKFTSS 296 >ref|XP_020101246.1| histone H2B.4-like [Ananas comosus] Length = 192 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 102 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 149 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 173 ELAKHAVSEGTKAVTKFTSS 192 >ref|XP_022752776.1| histone H2B-like [Durio zibethinus] Length = 176 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 47/48 (97%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQEASRLA Sbjct: 86 TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLA 133 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 157 ELAKHAVSEGTKAVTKFTSS 176 >ref|XP_020108524.1| histone H2B.11-like [Ananas comosus] Length = 163 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 73 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 120 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 144 ELAKHAVSEGTKAVTKFTSS 163 >ref|XP_020108522.1| histone H2B.11-like [Ananas comosus] gb|OAY68483.1| putative histone H2B.1 [Ananas comosus] gb|OAY68501.1| putative histone H2B.1 [Ananas comosus] Length = 163 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 73 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 120 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 144 ELAKHAVSEGTKAVTKFTSS 163 >gb|OAY68487.1| Histone H2B.6 [Ananas comosus] Length = 161 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 71 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 118 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 142 ELAKHAVSEGTKAVTKFTSS 161 >gb|OAY84720.1| Histone H2B [Ananas comosus] Length = 157 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 67 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 114 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 138 ELAKHAVSEGTKAVTKFTSS 157 >gb|PKA51928.1| Histone H2B.6 [Apostasia shenzhenica] Length = 155 Score = 94.0 bits (232), Expect(2) = 6e-23 Identities = 47/48 (97%), Positives = 48/48 (100%) Frame = +3 Query: 111 TETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 254 +ETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA Sbjct: 65 SETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLA 112 Score = 41.6 bits (96), Expect(2) = 6e-23 Identities = 20/20 (100%), Positives = 20/20 (100%) Frame = +1 Query: 292 ELAKHAVSEGTKAVTKFTSS 351 ELAKHAVSEGTKAVTKFTSS Sbjct: 136 ELAKHAVSEGTKAVTKFTSS 155