BLASTX nr result
ID: Cheilocostus21_contig00004742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00004742 (638 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-co... 100 4e-23 gb|ARU09637.1| stress associated protein [Musa AAB Group] 100 6e-23 ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-co... 100 6e-23 gb|ACL01101.1| zinc finger protein [Phyllostachys edulis] 99 2e-22 gb|ADF80942.1| zinc finger protein [Phyllostachys praecox] 99 2e-22 gb|ADF80943.1| zinc finger protein [Phyllostachys vivax] 97 6e-22 ref|XP_020197560.1| zinc finger A20 and AN1 domain-containing st... 97 1e-21 dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgar... 96 2e-21 gb|ACM68451.1| stress-associated protein 1, partial [Solanum pen... 93 3e-21 gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] >gi|... 93 3e-21 gb|OEL16871.1| Zinc finger A20 and AN1 domain-containing stress-... 95 5e-21 ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-co... 94 8e-21 ref|XP_002460447.1| zinc finger A20 and AN1 domain-containing st... 95 8e-21 ref|XP_019186659.1| PREDICTED: zinc finger A20 and AN1 domain-co... 95 9e-21 gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-... 92 9e-21 ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-co... 95 9e-21 ref|XP_022983489.1| zinc finger A20 and AN1 domain-containing st... 94 1e-20 ref|XP_022935503.1| zinc finger A20 and AN1 domain-containing st... 94 1e-20 ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-co... 94 1e-20 ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-co... 94 1e-20 >ref|XP_009418201.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 1-like [Musa acuminata subsp. malaccensis] Length = 155 Score = 100 bits (248), Expect = 4e-23 Identities = 47/80 (58%), Positives = 52/80 (65%) Frame = +1 Query: 1 PQIRSPEPSELAKXXXXXXXXXXXXXXXXXXXXRQVNRCFSCRKRVGLTGFRCRCGELFC 180 P IRSP+P++ A+ R+VNRC SCRKRVG TGFRCRCGELFC Sbjct: 61 PSIRSPDPADRAEEQGAPTAALASPAPAPA---RKVNRCLSCRKRVGFTGFRCRCGELFC 117 Query: 181 GEHRYSDRHGCSYDYKAXXR 240 GEHRYSDRH C YDYKA R Sbjct: 118 GEHRYSDRHDCGYDYKAAAR 137 >gb|ARU09637.1| stress associated protein [Musa AAB Group] Length = 155 Score = 99.8 bits (247), Expect = 6e-23 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQV+RCFSCRKRVGLTGFRCRCG+LFCGEHRYSDRH CSYDYKA R Sbjct: 91 RQVSRCFSCRKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKAAAR 137 >ref|XP_009391817.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 11-like [Musa acuminata subsp. malaccensis] Length = 155 Score = 99.8 bits (247), Expect = 6e-23 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQV+RCFSCRKRVGLTGFRCRCG+LFCGEHRYSDRH CSYDYKA R Sbjct: 91 RQVSRCFSCRKRVGLTGFRCRCGDLFCGEHRYSDRHDCSYDYKAAAR 137 >gb|ACL01101.1| zinc finger protein [Phyllostachys edulis] Length = 164 Score = 98.6 bits (244), Expect = 2e-22 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKA R Sbjct: 102 VNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAAR 146 >gb|ADF80942.1| zinc finger protein [Phyllostachys praecox] Length = 165 Score = 98.6 bits (244), Expect = 2e-22 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKA R Sbjct: 103 VNRCSSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAATR 147 >gb|ADF80943.1| zinc finger protein [Phyllostachys vivax] Length = 163 Score = 97.4 bits (241), Expect = 6e-22 Identities = 41/45 (91%), Positives = 42/45 (93%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKR+GLTGFRCRCGELFCGEHRYSDRHGCSYDYKA R Sbjct: 101 VNRCSSCRKRLGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAAAR 145 >ref|XP_020197560.1| zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Aegilops tauschii subsp. tauschii] Length = 165 Score = 96.7 bits (239), Expect = 1e-21 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKRVGLTGFRCRCG++FCGEHRYSDRHGCSYDYKA R Sbjct: 103 VNRCSSCRKRVGLTGFRCRCGDMFCGEHRYSDRHGCSYDYKAAAR 147 >dbj|BAK03526.1| predicted protein [Hordeum vulgare subsp. vulgare] dbj|BAK00339.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 163 Score = 96.3 bits (238), Expect = 2e-21 Identities = 40/45 (88%), Positives = 42/45 (93%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKRVGLTGFRCRCG++FCGEHRYSDRHGCSYDYKA R Sbjct: 101 VNRCSSCRKRVGLTGFRCRCGDVFCGEHRYSDRHGCSYDYKAAAR 145 >gb|ACM68451.1| stress-associated protein 1, partial [Solanum pennellii] Length = 87 Score = 93.2 bits (230), Expect = 3e-21 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 R+VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYK R Sbjct: 23 REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGR 69 >gb|AAR83854.1| induced stolon tip protein [Capsicum annuum] gb|PHT59116.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum baccatum] gb|PHU30166.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum chinense] Length = 88 Score = 93.2 bits (230), Expect = 3e-21 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 R+VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYK R Sbjct: 24 REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKTAGR 70 >gb|OEL16871.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Dichanthelium oligosanthes] Length = 168 Score = 95.1 bits (235), Expect = 5e-21 Identities = 44/75 (58%), Positives = 45/75 (60%) Frame = +1 Query: 16 PEPSELAKXXXXXXXXXXXXXXXXXXXXRQVNRCFSCRKRVGLTGFRCRCGELFCGEHRY 195 P P ELA VNRC SCRKRVGLTGFRCRCGELFCG HRY Sbjct: 76 PPPMELASPADAAVDLPALAAPAPAAARTSVNRCSSCRKRVGLTGFRCRCGELFCGAHRY 135 Query: 196 SDRHGCSYDYKAXXR 240 SDRHGCSYDY+ R Sbjct: 136 SDRHGCSYDYRGAAR 150 >ref|XP_010913137.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 11-like [Elaeis guineensis] Length = 158 Score = 94.4 bits (233), Expect = 8e-21 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH CS+DYKA R Sbjct: 94 RQVNRCAGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGR 140 >ref|XP_002460447.1| zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Sorghum bicolor] gb|EER96968.1| hypothetical protein SORBI_3002G245800 [Sorghum bicolor] gb|OQU89685.1| hypothetical protein SORBI_3002G245800 [Sorghum bicolor] gb|OQU89686.1| hypothetical protein SORBI_3002G245800 [Sorghum bicolor] gb|OQU89687.1| hypothetical protein SORBI_3002G245800 [Sorghum bicolor] Length = 172 Score = 94.7 bits (234), Expect = 8e-21 Identities = 40/45 (88%), Positives = 40/45 (88%) Frame = +1 Query: 106 VNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 VNRC SCRKRVGLTGFRCRCGELFCG HRYSDRHGCSYDYK R Sbjct: 110 VNRCSSCRKRVGLTGFRCRCGELFCGAHRYSDRHGCSYDYKGAGR 154 >ref|XP_019186659.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 174 Score = 94.7 bits (234), Expect = 9e-21 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 R+VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYKA R Sbjct: 110 REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGR 156 >gb|PHT93552.1| Zinc finger A20 and AN1 domain-containing stress-associated protein 1 [Capsicum annuum] Length = 86 Score = 92.0 bits (227), Expect = 9e-21 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYK 228 R+VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYK Sbjct: 24 REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYK 66 >ref|XP_019158911.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Ipomoea nil] Length = 176 Score = 94.7 bits (234), Expect = 9e-21 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 R+VNRC CR++VGLTGFRCRCGELFCGEHRYSDRH CSYDYKA R Sbjct: 112 REVNRCSGCRRKVGLTGFRCRCGELFCGEHRYSDRHDCSYDYKAAGR 158 >ref|XP_022983489.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita maxima] Length = 169 Score = 94.4 bits (233), Expect = 1e-20 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH CS+DYKA R Sbjct: 105 RQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGR 151 >ref|XP_022935503.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucurbita moschata] Length = 169 Score = 94.4 bits (233), Expect = 1e-20 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH CS+DYKA R Sbjct: 105 RQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGR 151 >ref|XP_008461789.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis melo] Length = 169 Score = 94.4 bits (233), Expect = 1e-20 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH CS+DYKA R Sbjct: 105 RQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGR 151 >ref|XP_004149600.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Cucumis sativus] gb|KGN58601.1| hypothetical protein Csa_3G697940 [Cucumis sativus] Length = 169 Score = 94.4 bits (233), Expect = 1e-20 Identities = 40/47 (85%), Positives = 41/47 (87%) Frame = +1 Query: 100 RQVNRCFSCRKRVGLTGFRCRCGELFCGEHRYSDRHGCSYDYKAXXR 240 RQVNRC CRKRVGLTGFRCRCGELFC EHRYSDRH CS+DYKA R Sbjct: 105 RQVNRCSGCRKRVGLTGFRCRCGELFCAEHRYSDRHDCSFDYKAAGR 151