BLASTX nr result
ID: Cheilocostus21_contig00004486
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00004486 (1027 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PAN20319.1| hypothetical protein PAHAL_C03626 [Panicum hallii] 58 3e-06 ref|XP_020108005.1| 40S ribosomal protein S7 [Ananas comosus] >g... 57 6e-06 >gb|PAN20319.1| hypothetical protein PAHAL_C03626 [Panicum hallii] Length = 192 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -3 Query: 560 TAIHKGILEDIVYLVEIIGKRIRYCLDGAKVMKV 459 TA+H GILED+VY EI+GKR+RY LDGAKVMKV Sbjct: 120 TAVHDGILEDVVYPAEIVGKRVRYHLDGAKVMKV 153 >ref|XP_020108005.1| 40S ribosomal protein S7 [Ananas comosus] ref|XP_020108006.1| 40S ribosomal protein S7 [Ananas comosus] ref|XP_020108007.1| 40S ribosomal protein S7 [Ananas comosus] Length = 192 Score = 57.0 bits (136), Expect = 6e-06 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = -3 Query: 560 TAIHKGILEDIVYLVEIIGKRIRYCLDGAKVMKV 459 TA+H+GILED+VY EI+GKRIRY LDG+K+MK+ Sbjct: 120 TAVHEGILEDVVYPAEIVGKRIRYRLDGSKIMKI 153