BLASTX nr result
ID: Cheilocostus21_contig00004254
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00004254 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008801908.1| PREDICTED: telomere repeat-binding protein 5... 75 8e-13 ref|XP_010937605.1| PREDICTED: telomere repeat-binding protein 2... 75 9e-13 ref|XP_007140326.1| hypothetical protein PHAVU_008G1030001g, par... 67 2e-12 ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 2... 74 2e-12 ref|XP_009414324.1| PREDICTED: telomere repeat-binding protein 2... 72 7e-12 ref|XP_010920568.1| PREDICTED: telomere repeat-binding protein 5... 72 1e-11 ref|XP_021278052.1| telomere repeat-binding protein 5 isoform X1... 72 1e-11 ref|XP_024028076.1| telomere repeat-binding protein 5 isoform X2... 71 1e-11 ref|XP_024028075.1| telomere repeat-binding protein 5 isoform X1... 71 1e-11 gb|EXC10679.1| Telomere repeat-binding protein 5 [Morus notabilis] 71 1e-11 gb|EOY34005.1| TRF-like 2, putative isoform 2 [Theobroma cacao] 70 2e-11 gb|EOY34004.1| TRF-like 2, putative isoform 1 [Theobroma cacao] 70 3e-11 ref|XP_020274364.1| telomere repeat-binding protein 5-like isofo... 70 3e-11 ref|XP_020274363.1| telomere repeat-binding protein 2-like isofo... 70 3e-11 ref|XP_020086621.1| telomere repeat-binding protein 2-like isofo... 70 5e-11 ref|XP_020086620.1| telomere repeat-binding protein 2-like isofo... 70 5e-11 ref|XP_020086619.1| telomere repeat-binding protein 2-like isofo... 70 5e-11 ref|XP_020086618.1| telomere repeat-binding protein 2-like isofo... 70 5e-11 gb|OAY68828.1| Telomere-binding protein 1 [Ananas comosus] 70 5e-11 ref|XP_020086617.1| telomere repeat-binding protein 2-like isofo... 70 5e-11 >ref|XP_008801908.1| PREDICTED: telomere repeat-binding protein 5-like [Phoenix dactylifera] Length = 440 Score = 74.7 bits (182), Expect = 8e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAE 315 QQRRGEPVPQELLDRVLSAHAYWSQQQ++LQVKP PPAE Sbjct: 398 QQRRGEPVPQELLDRVLSAHAYWSQQQARLQVKP-PPAE 435 >ref|XP_010937605.1| PREDICTED: telomere repeat-binding protein 2-like [Elaeis guineensis] Length = 709 Score = 74.7 bits (182), Expect = 9e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAE 315 QQRRGEPVPQELLDRVLSAHAYWSQQQ++LQVKP PPAE Sbjct: 667 QQRRGEPVPQELLDRVLSAHAYWSQQQARLQVKP-PPAE 704 >ref|XP_007140326.1| hypothetical protein PHAVU_008G1030001g, partial [Phaseolus vulgaris] gb|ESW12320.1| hypothetical protein PHAVU_008G1030001g, partial [Phaseolus vulgaris] Length = 49 Score = 67.4 bits (163), Expect = 2e-12 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPL 327 QQRRGEPVPQELLDRVL+AHAYWSQQQ K Q+KPL Sbjct: 15 QQRRGEPVPQELLDRVLAAHAYWSQQQCKHQLKPL 49 >ref|XP_008784600.1| PREDICTED: telomere repeat-binding protein 2 [Phoenix dactylifera] Length = 704 Score = 73.6 bits (179), Expect = 2e-12 Identities = 35/39 (89%), Positives = 38/39 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAE 315 QQRRGEPVPQELLDRVLSAHAYWSQQQ++LQVKP PPA+ Sbjct: 662 QQRRGEPVPQELLDRVLSAHAYWSQQQARLQVKP-PPAQ 699 >ref|XP_009414324.1| PREDICTED: telomere repeat-binding protein 2 [Musa acuminata subsp. malaccensis] Length = 702 Score = 72.0 bits (175), Expect = 7e-12 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAE 315 QQRRGEPVPQELLDRVL+AHAYWSQ Q+KLQ+KP P AE Sbjct: 659 QQRRGEPVPQELLDRVLAAHAYWSQHQAKLQLKPPPSAE 697 >ref|XP_010920568.1| PREDICTED: telomere repeat-binding protein 5-like [Elaeis guineensis] ref|XP_010920569.1| PREDICTED: telomere repeat-binding protein 5-like [Elaeis guineensis] ref|XP_010920570.1| PREDICTED: telomere repeat-binding protein 5-like [Elaeis guineensis] ref|XP_010920571.1| PREDICTED: telomere repeat-binding protein 5-like [Elaeis guineensis] Length = 699 Score = 71.6 bits (174), Expect = 1e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKP 330 QQRRGEPVPQELLDRVLSAHAYWSQQQ+KLQVKP Sbjct: 658 QQRRGEPVPQELLDRVLSAHAYWSQQQAKLQVKP 691 >ref|XP_021278052.1| telomere repeat-binding protein 5 isoform X1 [Herrania umbratica] Length = 716 Score = 71.6 bits (174), Expect = 1e-11 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAENFCSYPNSIGQGIDSC 267 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KP P Y NS +G +C Sbjct: 655 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPQQPETCLLLY-NSTMRGSSTC 708 >ref|XP_024028076.1| telomere repeat-binding protein 5 isoform X2 [Morus notabilis] Length = 665 Score = 71.2 bits (173), Expect = 1e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLP 324 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KPLP Sbjct: 624 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPLP 659 >ref|XP_024028075.1| telomere repeat-binding protein 5 isoform X1 [Morus notabilis] Length = 692 Score = 71.2 bits (173), Expect = 1e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLP 324 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KPLP Sbjct: 651 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPLP 686 >gb|EXC10679.1| Telomere repeat-binding protein 5 [Morus notabilis] Length = 720 Score = 71.2 bits (173), Expect = 1e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLP 324 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KPLP Sbjct: 679 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPLP 714 >gb|EOY34005.1| TRF-like 2, putative isoform 2 [Theobroma cacao] Length = 517 Score = 70.5 bits (171), Expect = 2e-11 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAENFCSYPNSIGQG 279 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KP P Y ++I G Sbjct: 456 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPQQPETCLLLYNSTIRGG 506 >gb|EOY34004.1| TRF-like 2, putative isoform 1 [Theobroma cacao] Length = 716 Score = 70.5 bits (171), Expect = 3e-11 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKPLPPAENFCSYPNSIGQG 279 QQRRGEPVPQELLDRVL+AHAYWSQQQ+K Q+KP P Y ++I G Sbjct: 655 QQRRGEPVPQELLDRVLTAHAYWSQQQAKQQLKPQQPETCLLLYNSTIRGG 705 >ref|XP_020274364.1| telomere repeat-binding protein 5-like isoform X2 [Asparagus officinalis] Length = 535 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKP 330 QQRRGEPVPQELLDRVLSAHAYWSQQQ+KLQ KP Sbjct: 493 QQRRGEPVPQELLDRVLSAHAYWSQQQAKLQAKP 526 >ref|XP_020274363.1| telomere repeat-binding protein 2-like isoform X1 [Asparagus officinalis] gb|ONK62234.1| uncharacterized protein A4U43_C07F1750 [Asparagus officinalis] Length = 641 Score = 70.1 bits (170), Expect = 3e-11 Identities = 32/34 (94%), Positives = 33/34 (97%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVKP 330 QQRRGEPVPQELLDRVLSAHAYWSQQQ+KLQ KP Sbjct: 599 QQRRGEPVPQELLDRVLSAHAYWSQQQAKLQAKP 632 >ref|XP_020086621.1| telomere repeat-binding protein 2-like isoform X7 [Ananas comosus] Length = 658 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 609 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 649 >ref|XP_020086620.1| telomere repeat-binding protein 2-like isoform X6 [Ananas comosus] Length = 659 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 610 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 650 >ref|XP_020086619.1| telomere repeat-binding protein 2-like isoform X5 [Ananas comosus] Length = 660 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 611 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 651 >ref|XP_020086618.1| telomere repeat-binding protein 2-like isoform X4 [Ananas comosus] Length = 661 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 612 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 652 >gb|OAY68828.1| Telomere-binding protein 1 [Ananas comosus] Length = 688 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 639 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 679 >ref|XP_020086617.1| telomere repeat-binding protein 2-like isoform X3 [Ananas comosus] Length = 697 Score = 69.7 bits (169), Expect = 5e-11 Identities = 34/41 (82%), Positives = 38/41 (92%), Gaps = 1/41 (2%) Frame = -3 Query: 431 QQRRGEPVPQELLDRVLSAHAYWSQQQSKLQVK-PLPPAEN 312 QQRRGEPVPQELLDRVLSAHAYW+QQQ+KLQ K P+P AE+ Sbjct: 648 QQRRGEPVPQELLDRVLSAHAYWTQQQAKLQPKPPVPMAES 688