BLASTX nr result
ID: Cheilocostus21_contig00003908
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00003908 (448 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009403367.1| PREDICTED: uncharacterized protein LOC103986... 52 1e-05 >ref|XP_009403367.1| PREDICTED: uncharacterized protein LOC103986938 [Musa acuminata subsp. malaccensis] Length = 130 Score = 52.4 bits (124), Expect = 1e-05 Identities = 30/45 (66%), Positives = 31/45 (68%) Frame = -1 Query: 448 IMKSQRNXXXXXXXXXXXXXLFSVTSLVVRIGQLNQRVEKLKRSE 314 IMKSQRN LFSVTSLVVRI QLNQR+EKLKRSE Sbjct: 86 IMKSQRNALLIASALLLYWLLFSVTSLVVRIDQLNQRIEKLKRSE 130