BLASTX nr result
ID: Cheilocostus21_contig00002851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00002851 (400 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009415817.1| PREDICTED: COBRA-like protein 1 [Musa acumin... 58 4e-07 >ref|XP_009415817.1| PREDICTED: COBRA-like protein 1 [Musa acuminata subsp. malaccensis] Length = 458 Score = 58.2 bits (139), Expect = 4e-07 Identities = 25/33 (75%), Positives = 26/33 (78%) Frame = +1 Query: 1 PPDSYPWLPNAGSRLTRTSFAVLFAALTWLLIY 99 PPDSYPWLPNA +RLT T LFAAL WLLIY Sbjct: 425 PPDSYPWLPNAATRLTSTMMMALFAALAWLLIY 457