BLASTX nr result
ID: Cheilocostus21_contig00002043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00002043 (566 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP11440.1| unnamed protein product [Coffea canephora] 60 2e-07 ref|XP_011100579.1| UDP-galactose transporter 2 [Sesamum indicum... 60 3e-07 gb|OWM63968.1| hypothetical protein CDL15_Pgr012009 [Punica gran... 60 4e-07 ref|XP_002533887.1| PREDICTED: UDP-galactose transporter 2 [Rici... 60 4e-07 emb|CDP11437.1| unnamed protein product [Coffea canephora] 59 5e-07 ref|XP_011074099.1| UDP-galactose transporter 2 [Sesamum indicum... 59 5e-07 ref|XP_012845930.1| PREDICTED: UDP-galactose transporter 2-like ... 59 5e-07 ref|XP_022568237.1| UDP-rhamnose/UDP-galactose transporter 6-lik... 59 6e-07 ref|XP_012838948.1| PREDICTED: UDP-galactose transporter 2-like ... 59 7e-07 gb|PIN17844.1| Glucose-6-phosphate/phosphate and phosphoenolpyru... 59 7e-07 gb|PIN14899.1| Glucose-6-phosphate/phosphate and phosphoenolpyru... 59 7e-07 ref|XP_019434998.1| PREDICTED: UDP-galactose transporter 2-like ... 59 7e-07 ref|XP_010242229.1| PREDICTED: UDP-galactose transporter 2-like ... 59 7e-07 ref|XP_003634527.1| PREDICTED: UDP-galactose transporter 2 [Viti... 59 7e-07 ref|XP_003602508.2| nucleotide/sugar transporter family protein ... 59 7e-07 gb|AFK39529.1| unknown [Medicago truncatula] 59 8e-07 gb|KRH08643.1| hypothetical protein GLYMA_16G163500 [Glycine max] 59 9e-07 ref|XP_022568234.1| UDP-rhamnose/UDP-galactose transporter 6-lik... 59 9e-07 ref|XP_006599473.1| PREDICTED: UDP-galactose transporter 2-like ... 59 9e-07 ref|XP_003518502.1| PREDICTED: UDP-galactose transporter 2 [Glyc... 59 9e-07 >emb|CDP11440.1| unnamed protein product [Coffea canephora] Length = 224 Score = 59.7 bits (143), Expect = 2e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 57 TSLQQYYVHFLQRKYSLSSFNLLGHTAPAQAASLLLVGPFLDYWLTNK 104 >ref|XP_011100579.1| UDP-galactose transporter 2 [Sesamum indicum] ref|XP_011100585.1| UDP-galactose transporter 2 [Sesamum indicum] Length = 335 Score = 60.1 bits (144), Expect = 3e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 167 TSLQQYYVHFLQRKYSLTSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214 >gb|OWM63968.1| hypothetical protein CDL15_Pgr012009 [Punica granatum] gb|PKI72016.1| hypothetical protein CRG98_007562 [Punica granatum] Length = 334 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F QKK+S+ S N LGHT PAQAASLLL GPFLDY +T+K Sbjct: 167 TSLQQYYVHFLQKKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWMTNK 214 >ref|XP_002533887.1| PREDICTED: UDP-galactose transporter 2 [Ricinus communis] ref|XP_015583672.1| PREDICTED: UDP-galactose transporter 2 [Ricinus communis] gb|EEF28498.1| organic anion transporter, putative [Ricinus communis] Length = 335 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+++S+ S N LGHT PAQAASLL+ GPFLDY LTHK Sbjct: 167 TSLQQYYVHFLQRRYSLGSFNLLGHTAPAQAASLLVVGPFLDYWLTHK 214 >emb|CDP11437.1| unnamed protein product [Coffea canephora] Length = 332 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 167 TSLQQYYVHFLQRKYSLGSFNLLGHTAPAQAASLLLVGPFLDYWLTNK 214 >ref|XP_011074099.1| UDP-galactose transporter 2 [Sesamum indicum] ref|XP_011074100.1| UDP-galactose transporter 2 [Sesamum indicum] ref|XP_011074102.1| UDP-galactose transporter 2 [Sesamum indicum] ref|XP_020548348.1| UDP-galactose transporter 2 [Sesamum indicum] Length = 335 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 167 TSLQQYYVHFLQRKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214 >ref|XP_012845930.1| PREDICTED: UDP-galactose transporter 2-like [Erythranthe guttata] gb|EYU30281.1| hypothetical protein MIMGU_mgv1a009610mg [Erythranthe guttata] Length = 337 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L + Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 171 TSLQQYYVHYLQRKYSLTSFNLLGHTAPAQAASLLLIGPFLDYLLTNK 218 >ref|XP_022568237.1| UDP-rhamnose/UDP-galactose transporter 6-like isoform X2 [Brassica napus] Length = 247 Score = 58.5 bits (140), Expect = 6e-07 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHKILALLYY 29 T L + Q+K+S+ S NFLGHT PAQAA+LL+ GPFLDY LT K + + Y Sbjct: 79 TSLQQYYVHYLQRKYSLSSFNFLGHTAPAQAATLLVVGPFLDYWLTEKRVDMYDY 133 >ref|XP_012838948.1| PREDICTED: UDP-galactose transporter 2-like [Erythranthe guttata] ref|XP_012838949.1| PREDICTED: UDP-galactose transporter 2-like [Erythranthe guttata] gb|EYU36556.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata] gb|EYU36557.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata] gb|EYU36558.1| hypothetical protein MIMGU_mgv1a009740mg [Erythranthe guttata] Length = 333 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -2 Query: 169 AFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 +F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 175 SFLQRKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214 >gb|PIN17844.1| Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Handroanthus impetiginosus] Length = 335 Score = 58.9 bits (141), Expect = 7e-07 Identities = 31/50 (62%), Positives = 34/50 (68%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHKIL 44 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT K L Sbjct: 167 TSLQQYYVHFLQRKYSLSSVNLLGHTAPAQAASLLLLGPFLDYWLTSKRL 216 >gb|PIN14899.1| Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter [Handroanthus impetiginosus] Length = 335 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/48 (60%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT P+QAASLLL GPFLDY LT+K Sbjct: 167 TSLQQYYVHFLQRKYSLTSFNLLGHTAPSQAASLLLLGPFLDYWLTNK 214 >ref|XP_019434998.1| PREDICTED: UDP-galactose transporter 2-like [Lupinus angustifolius] ref|XP_019434999.1| PREDICTED: UDP-galactose transporter 2-like [Lupinus angustifolius] gb|OIV89243.1| hypothetical protein TanjilG_24363 [Lupinus angustifolius] Length = 335 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+SV S N LGHT PAQAASLLL GPF+DY LT+K Sbjct: 176 FLQRKYSVGSFNLLGHTAPAQAASLLLVGPFMDYWLTNK 214 >ref|XP_010242229.1| PREDICTED: UDP-galactose transporter 2-like [Nelumbo nucifera] Length = 335 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/48 (62%), Positives = 34/48 (70%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 T L F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 167 TSLQQYYVHFLQRKYSLGSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214 >ref|XP_003634527.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera] ref|XP_010665174.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera] ref|XP_019072315.1| PREDICTED: UDP-galactose transporter 2 [Vitis vinifera] emb|CBI18242.3| unnamed protein product, partial [Vitis vinifera] Length = 335 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHKILALLYY 29 T L F Q+K+S+ S N LGHT PAQA SLLL GPFLDY LT+K + + Y Sbjct: 167 TSLQQYYVHFLQRKYSLSSFNLLGHTAPAQAGSLLLLGPFLDYWLTNKRVDMYQY 221 >ref|XP_003602508.2| nucleotide/sugar transporter family protein [Medicago truncatula] gb|AES72759.2| nucleotide/sugar transporter family protein [Medicago truncatula] Length = 286 Score = 58.5 bits (140), Expect = 7e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+S+ S N LGHT PAQAASLLL GPF+DY LT+K Sbjct: 127 FLQRKYSIGSFNLLGHTAPAQAASLLLVGPFMDYWLTNK 165 >gb|AFK39529.1| unknown [Medicago truncatula] Length = 300 Score = 58.5 bits (140), Expect = 8e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+S+ S N LGHT PAQAASLLL GPF+DY LT+K Sbjct: 141 FLQRKYSIGSFNLLGHTAPAQAASLLLVGPFMDYWLTNK 179 >gb|KRH08643.1| hypothetical protein GLYMA_16G163500 [Glycine max] Length = 317 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 171 FLQRKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 209 >ref|XP_022568234.1| UDP-rhamnose/UDP-galactose transporter 6-like isoform X1 [Brassica napus] ref|XP_022568235.1| UDP-rhamnose/UDP-galactose transporter 6-like isoform X1 [Brassica napus] ref|XP_022568236.1| UDP-rhamnose/UDP-galactose transporter 6-like isoform X1 [Brassica napus] Length = 318 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/55 (52%), Positives = 37/55 (67%) Frame = -2 Query: 193 TDLVSVVCAFPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHKILALLYY 29 T L + Q+K+S+ S NFLGHT PAQAA+LL+ GPFLDY LT K + + Y Sbjct: 150 TSLQQYYVHYLQRKYSLSSFNFLGHTAPAQAATLLVVGPFLDYWLTEKRVDMYDY 204 >ref|XP_006599473.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max] ref|XP_006599474.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max] ref|XP_006599475.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max] ref|XP_006599476.1| PREDICTED: UDP-galactose transporter 2-like [Glycine max] gb|KHN41307.1| UDP-galactose transporter 2 [Glycine soja] Length = 322 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 176 FLQRKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214 >ref|XP_003518502.1| PREDICTED: UDP-galactose transporter 2 [Glycine max] ref|XP_014621175.1| PREDICTED: UDP-galactose transporter 2 [Glycine max] gb|KHN00738.1| UDP-galactose transporter 2 [Glycine soja] gb|KRH70257.1| hypothetical protein GLYMA_02G079100 [Glycine max] gb|KRH70258.1| hypothetical protein GLYMA_02G079100 [Glycine max] Length = 322 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -2 Query: 166 FPQKKFSVVSSNFLGHTTPAQAASLLLTGPFLDYCLTHK 50 F Q+K+S+ S N LGHT PAQAASLLL GPFLDY LT+K Sbjct: 176 FLQRKYSLSSFNLLGHTAPAQAASLLLLGPFLDYWLTNK 214