BLASTX nr result
ID: Cheilocostus21_contig00001691
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00001691 (1427 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009413764.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 79 3e-14 ref|XP_020245321.1| peptidyl-prolyl cis-trans isomerase Pin1 [As... 79 5e-14 ref|XP_018822042.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 79 7e-14 ref|XP_010934204.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 78 9e-14 gb|OVA12849.1| Peptidyl-prolyl cis-trans isomerase [Macleaya cor... 78 1e-13 sp|Q9LEK8.1|PIN1_DIGLA RecName: Full=Peptidyl-prolyl cis-trans i... 78 1e-13 ref|XP_022841658.1| peptidyl-prolyl cis-trans isomerase Pin1-lik... 78 1e-13 ref|XP_023884444.1| peptidyl-prolyl cis-trans isomerase Pin1 [Qu... 78 1e-13 ref|XP_016201976.1| peptidyl-prolyl cis-trans isomerase Pin1 [Ar... 78 1e-13 ref|XP_015964250.1| peptidyl-prolyl cis-trans isomerase Pin1 [Ar... 78 1e-13 ref|XP_015964238.1| peptidyl-prolyl cis-trans isomerase Pin1 [Ar... 78 1e-13 ref|XP_010033471.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 78 1e-13 ref|XP_009381989.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 77 2e-13 ref|XP_011099817.1| peptidyl-prolyl cis-trans isomerase Pin1 [Se... 77 2e-13 ref|XP_010920237.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 77 2e-13 gb|PON99486.1| Peptidyl-prolyl cis-trans isomerase [Trema orient... 77 2e-13 ref|XP_021605714.1| peptidyl-prolyl cis-trans isomerase Pin1-lik... 77 3e-13 ref|XP_021605715.1| peptidyl-prolyl cis-trans isomerase Pin1-lik... 77 3e-13 gb|PON39169.1| Peptidyl-prolyl cis-trans isomerase [Parasponia a... 77 3e-13 ref|XP_022894525.1| peptidyl-prolyl cis-trans isomerase Pin1-lik... 77 3e-13 >ref|XP_009413764.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Musa acuminata subsp. malaccensis] Length = 118 Score = 79.3 bits (194), Expect = 3e-14 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = +3 Query: 975 RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 RFGRGQMQKPFEEATYALKVGE+S +VDTDSGVHIILRTG Sbjct: 79 RFGRGQMQKPFEEATYALKVGELSDVVDTDSGVHIILRTG 118 >ref|XP_020245321.1| peptidyl-prolyl cis-trans isomerase Pin1 [Asparagus officinalis] gb|ONK80199.1| uncharacterized protein A4U43_C01F14990 [Asparagus officinalis] Length = 119 Score = 79.0 bits (193), Expect = 5e-14 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = +3 Query: 975 RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 RFGRGQMQKPFEEAT+ALKVGEIS IVDTDSGVHIILRTG Sbjct: 80 RFGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIILRTG 119 >ref|XP_018822042.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Juglans regia] Length = 122 Score = 78.6 bits (192), Expect = 7e-14 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHIILRTG Sbjct: 84 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIILRTG 122 >ref|XP_010934204.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Elaeis guineensis] Length = 119 Score = 78.2 bits (191), Expect = 9e-14 Identities = 40/54 (74%), Positives = 43/54 (79%) Frame = +3 Query: 933 H*HCSWWTANEMI*RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 H CS + RFGRGQMQKPFEEAT+ALKVGE+S IVDTDSGVHIILRTG Sbjct: 66 HSDCSSAKRGGDLGRFGRGQMQKPFEEATFALKVGEMSDIVDTDSGVHIILRTG 119 >gb|OVA12849.1| Peptidyl-prolyl cis-trans isomerase [Macleaya cordata] Length = 118 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 80 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 118 >sp|Q9LEK8.1|PIN1_DIGLA RecName: Full=Peptidyl-prolyl cis-trans isomerase Pin1; Short=PPIase Pin1; AltName: Full=DlPar13; AltName: Full=Rotamase Pin1 emb|CAB94994.1| peptidyl-prolyl cis-trans isomerase [Digitalis lanata] Length = 118 Score = 77.8 bits (190), Expect = 1e-13 Identities = 40/54 (74%), Positives = 42/54 (77%) Frame = +3 Query: 933 H*HCSWWTANEMI*RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 H HCS + FGRGQMQKPFEEAT+ALKVGEIS IVDTDSGVHII RTG Sbjct: 65 HSHCSSAKRGGDLGPFGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIIKRTG 118 >ref|XP_022841658.1| peptidyl-prolyl cis-trans isomerase Pin1-like [Olea europaea var. sylvestris] Length = 121 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 83 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 121 >ref|XP_023884444.1| peptidyl-prolyl cis-trans isomerase Pin1 [Quercus suber] Length = 125 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 87 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 125 >ref|XP_016201976.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arachis ipaensis] Length = 127 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 89 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >ref|XP_015964250.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arachis duranensis] ref|XP_020997860.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arachis duranensis] Length = 127 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 89 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >ref|XP_015964238.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arachis duranensis] ref|XP_016201948.1| peptidyl-prolyl cis-trans isomerase Pin1 [Arachis ipaensis] Length = 127 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 89 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >ref|XP_010033471.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1 [Eucalyptus grandis] Length = 127 Score = 77.8 bits (190), Expect = 1e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 89 FGRGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 127 >ref|XP_009381989.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Musa acuminata subsp. malaccensis] Length = 118 Score = 77.0 bits (188), Expect = 2e-13 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRT 1091 FGRGQMQKPFEEATYALKVG++SGIVDTDSGVHIILRT Sbjct: 80 FGRGQMQKPFEEATYALKVGDLSGIVDTDSGVHIILRT 117 >ref|XP_011099817.1| peptidyl-prolyl cis-trans isomerase Pin1 [Sesamum indicum] Length = 119 Score = 77.0 bits (188), Expect = 2e-13 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = +3 Query: 939 HCSWWTANEMI*RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 HCS + FGRGQMQKPFEEAT+ALK+GEIS IVDTDSGVHII+RTG Sbjct: 68 HCSSAKRGGDLGSFGRGQMQKPFEEATFALKLGEISDIVDTDSGVHIIMRTG 119 >ref|XP_010920237.1| PREDICTED: peptidyl-prolyl cis-trans isomerase Pin1-like [Elaeis guineensis] Length = 119 Score = 77.0 bits (188), Expect = 2e-13 Identities = 39/54 (72%), Positives = 43/54 (79%) Frame = +3 Query: 933 H*HCSWWTANEMI*RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 H CS + RFG+GQMQKPFEEAT+ALKVGE+S IVDTDSGVHIILRTG Sbjct: 66 HSDCSSAKRGGDLGRFGKGQMQKPFEEATFALKVGEMSDIVDTDSGVHIILRTG 119 >gb|PON99486.1| Peptidyl-prolyl cis-trans isomerase [Trema orientalis] Length = 121 Score = 77.0 bits (188), Expect = 2e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEAT+ALKVGEIS IVDTDSGVHIILRTG Sbjct: 83 FGRGQMQKPFEEATFALKVGEISDIVDTDSGVHIILRTG 121 >ref|XP_021605714.1| peptidyl-prolyl cis-trans isomerase Pin1-like isoform X1 [Manihot esculenta] Length = 130 Score = 77.0 bits (188), Expect = 3e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +3 Query: 957 ANEMI*RFGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 AN + FGRGQMQKPFE+ATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 85 ANIVTGPFGRGQMQKPFEDATYALKVGEISDIVDTDSGVHIIMRTG 130 >ref|XP_021605715.1| peptidyl-prolyl cis-trans isomerase Pin1-like isoform X2 [Manihot esculenta] gb|OAY57519.1| hypothetical protein MANES_02G103000 [Manihot esculenta] Length = 119 Score = 76.6 bits (187), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFE+ATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 81 FGRGQMQKPFEDATYALKVGEISDIVDTDSGVHIIMRTG 119 >gb|PON39169.1| Peptidyl-prolyl cis-trans isomerase [Parasponia andersonii] Length = 121 Score = 76.6 bits (187), Expect = 3e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FGRGQMQKPFEEAT+ALKVGEIS IVDTDSGVHIILRTG Sbjct: 83 FGRGQMQKPFEEATFALKVGEISEIVDTDSGVHIILRTG 121 >ref|XP_022894525.1| peptidyl-prolyl cis-trans isomerase Pin1-like [Olea europaea var. sylvestris] Length = 122 Score = 76.6 bits (187), Expect = 3e-13 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = +3 Query: 978 FGRGQMQKPFEEATYALKVGEISGIVDTDSGVHIILRTG 1094 FG+GQMQKPFEEATYALKVGEIS IVDTDSGVHII+RTG Sbjct: 84 FGKGQMQKPFEEATYALKVGEISDIVDTDSGVHIIMRTG 122