BLASTX nr result
ID: Cheilocostus21_contig00001446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00001446 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009401741.1| PREDICTED: peroxidase 5-like [Musa acuminata... 60 1e-07 >ref|XP_009401741.1| PREDICTED: peroxidase 5-like [Musa acuminata subsp. malaccensis] Length = 325 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +1 Query: 1 DNSYYQGILKHRGLFTSDQTLVSSPSGAAQVHLFAANS 114 D SYYQGILKHRGLF+SDQTLVS+ S AA+V L A NS Sbjct: 253 DTSYYQGILKHRGLFSSDQTLVSTASSAAKVTLLATNS 290