BLASTX nr result
ID: Cheilocostus21_contig00001265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00001265 (902 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR65213.1| hypothetical protein CICLE_v10009993mg [Citrus cl... 85 3e-17 ref|XP_022886653.1| uncharacterized protein LOC111402517 [Olea e... 85 4e-17 ref|XP_015383963.1| PREDICTED: uncharacterized protein LOC102630... 85 4e-17 gb|ESR65215.1| hypothetical protein CICLE_v10009993mg [Citrus cl... 85 4e-17 ref|XP_011622332.1| uncharacterized protein LOC18431592 isoform ... 85 4e-17 ref|XP_015896402.1| PREDICTED: uncharacterized protein LOC107430... 85 4e-17 ref|XP_006451976.1| uncharacterized protein LOC18054192 isoform ... 85 4e-17 ref|XP_015383962.1| PREDICTED: uncharacterized protein LOC102630... 85 4e-17 ref|XP_006451974.1| uncharacterized protein LOC18054192 isoform ... 85 4e-17 ref|XP_011622331.1| uncharacterized protein LOC18431592 isoform ... 85 4e-17 ref|XP_006464689.1| PREDICTED: uncharacterized protein LOC102630... 85 4e-17 gb|OVA20198.1| hypothetical protein BVC80_155g8 [Macleaya cordata] 85 5e-17 ref|XP_015896395.1| PREDICTED: uncharacterized protein LOC107430... 85 6e-17 ref|XP_017433639.1| PREDICTED: uncharacterized protein LOC108340... 84 6e-17 gb|KOM50291.1| hypothetical protein LR48_Vigan08g111800 [Vigna a... 84 7e-17 ref|XP_021657235.1| uncharacterized protein LOC110647619 [Hevea ... 84 8e-17 ref|XP_021684588.1| uncharacterized protein LOC110667906 [Hevea ... 84 8e-17 ref|XP_021684587.1| uncharacterized protein LOC110667905 [Hevea ... 84 8e-17 ref|XP_010644233.1| PREDICTED: uncharacterized protein LOC100252... 84 9e-17 gb|PRQ31413.1| hypothetical protein RchiOBHm_Chr5g0035221 [Rosa ... 85 9e-17 >gb|ESR65213.1| hypothetical protein CICLE_v10009993mg [Citrus clementina] gb|KDO74195.1| hypothetical protein CISIN_1g034130mg [Citrus sinensis] Length = 97 Score = 85.1 bits (209), Expect = 3e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >ref|XP_022886653.1| uncharacterized protein LOC111402517 [Olea europaea var. sylvestris] Length = 98 Score = 85.1 bits (209), Expect = 4e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDP+SPSKWKEEHFV+++LTGWGLL++ Sbjct: 39 DHHGPPKVNFWEDPMSPSKWKEEHFVIVSLTGWGLLLF 76 >ref|XP_015383963.1| PREDICTED: uncharacterized protein LOC102630070 isoform X3 [Citrus sinensis] Length = 98 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >gb|ESR65215.1| hypothetical protein CICLE_v10009993mg [Citrus clementina] Length = 99 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >ref|XP_011622332.1| uncharacterized protein LOC18431592 isoform X2 [Amborella trichopoda] Length = 101 Score = 85.1 bits (209), Expect = 4e-17 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+++L+GWGLL Y Sbjct: 41 DHHGPPKVNFWEDPLSPSKWKEEHFVIVSLSGWGLLFY 78 >ref|XP_015896402.1| PREDICTED: uncharacterized protein LOC107430112 isoform X2 [Ziziphus jujuba] Length = 102 Score = 85.1 bits (209), Expect = 4e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPL+PSKWKEEHFV+++LTGWGLL+Y Sbjct: 42 DHHGPPKVNFWQDPLNPSKWKEEHFVIVSLTGWGLLLY 79 >ref|XP_006451976.1| uncharacterized protein LOC18054192 isoform X2 [Citrus clementina] gb|ESR65216.1| hypothetical protein CICLE_v10009993mg [Citrus clementina] gb|KDO74193.1| hypothetical protein CISIN_1g034130mg [Citrus sinensis] Length = 102 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >ref|XP_015383962.1| PREDICTED: uncharacterized protein LOC102630070 isoform X2 [Citrus sinensis] Length = 103 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >ref|XP_006451974.1| uncharacterized protein LOC18054192 isoform X1 [Citrus clementina] gb|ESR65214.1| hypothetical protein CICLE_v10009993mg [Citrus clementina] gb|KDO74194.1| hypothetical protein CISIN_1g034130mg [Citrus sinensis] Length = 103 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >ref|XP_011622331.1| uncharacterized protein LOC18431592 isoform X1 [Amborella trichopoda] Length = 104 Score = 85.1 bits (209), Expect = 4e-17 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+++L+GWGLL Y Sbjct: 41 DHHGPPKVNFWEDPLSPSKWKEEHFVIVSLSGWGLLFY 78 >ref|XP_006464689.1| PREDICTED: uncharacterized protein LOC102630070 isoform X1 [Citrus sinensis] Length = 104 Score = 85.1 bits (209), Expect = 4e-17 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWKEEHFV+I+ TGWGLL Y Sbjct: 44 DHHGPPKVNFWEDPLSPSKWKEEHFVIISATGWGLLFY 81 >gb|OVA20198.1| hypothetical protein BVC80_155g8 [Macleaya cordata] Length = 102 Score = 84.7 bits (208), Expect = 5e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DP+SPSKWKEEHFV+++LTGWG+LIY Sbjct: 39 DHHGPPKVNFWKDPMSPSKWKEEHFVIVSLTGWGVLIY 76 >ref|XP_015896395.1| PREDICTED: uncharacterized protein LOC107430112 isoform X1 [Ziziphus jujuba] Length = 119 Score = 85.1 bits (209), Expect = 6e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPL+PSKWKEEHFV+++LTGWGLL+Y Sbjct: 42 DHHGPPKVNFWQDPLNPSKWKEEHFVIVSLTGWGLLLY 79 >ref|XP_017433639.1| PREDICTED: uncharacterized protein LOC108340647 [Vigna angularis] Length = 96 Score = 84.3 bits (207), Expect = 6e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DP+SPSKWKEEHFV+I+L+GWGLL+Y Sbjct: 36 DHHGPPKVNFWKDPMSPSKWKEEHFVIISLSGWGLLVY 73 >gb|KOM50291.1| hypothetical protein LR48_Vigan08g111800 [Vigna angularis] dbj|BAT90190.1| hypothetical protein VIGAN_06138200 [Vigna angularis var. angularis] Length = 97 Score = 84.3 bits (207), Expect = 7e-17 Identities = 32/38 (84%), Positives = 38/38 (100%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DP+SPSKWKEEHFV+I+L+GWGLL+Y Sbjct: 36 DHHGPPKVNFWKDPMSPSKWKEEHFVIISLSGWGLLVY 73 >ref|XP_021657235.1| uncharacterized protein LOC110647619 [Hevea brasiliensis] Length = 102 Score = 84.3 bits (207), Expect = 8e-17 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPL+PSKWKEEHFV+++LTGWGLL Y Sbjct: 42 DHHGPPKVNFWQDPLNPSKWKEEHFVIVSLTGWGLLFY 79 >ref|XP_021684588.1| uncharacterized protein LOC110667906 [Hevea brasiliensis] Length = 102 Score = 84.3 bits (207), Expect = 8e-17 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPL+PSKWKEEHFV+++LTGWGLL Y Sbjct: 42 DHHGPPKVNFWQDPLNPSKWKEEHFVIVSLTGWGLLFY 79 >ref|XP_021684587.1| uncharacterized protein LOC110667905 [Hevea brasiliensis] Length = 102 Score = 84.3 bits (207), Expect = 8e-17 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPL+PSKWKEEHFV+++LTGWGLL Y Sbjct: 42 DHHGPPKVNFWQDPLNPSKWKEEHFVIVSLTGWGLLFY 79 >ref|XP_010644233.1| PREDICTED: uncharacterized protein LOC100252136 isoform X2 [Vitis vinifera] Length = 94 Score = 84.0 bits (206), Expect = 9e-17 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFW+DPLSPSKWKEEHFV+++L+GWGLL Y Sbjct: 38 DHHGPPKVNFWQDPLSPSKWKEEHFVIVSLSGWGLLFY 75 >gb|PRQ31413.1| hypothetical protein RchiOBHm_Chr5g0035221 [Rosa chinensis] Length = 119 Score = 84.7 bits (208), Expect = 9e-17 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = +1 Query: 220 DHHGPPKVNFWEDPLSPSKWKEEHFVLITLTGWGLLIY 333 DHHGPPKVNFWEDPLSPSKWK+EHFV+++L GWGLLIY Sbjct: 42 DHHGPPKVNFWEDPLSPSKWKKEHFVIVSLAGWGLLIY 79