BLASTX nr result
ID: Cheilocostus21_contig00000928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00000928 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_073981362.1| hypothetical protein [Enterococcus faecium] 54 3e-06 ref|WP_073495640.1| hypothetical protein [Enterococcus faecalis] 53 5e-06 >ref|WP_073981362.1| hypothetical protein [Enterococcus faecium] Length = 92 Score = 53.5 bits (127), Expect = 3e-06 Identities = 30/53 (56%), Positives = 31/53 (58%), Gaps = 5/53 (9%) Frame = +3 Query: 390 HERKFPGRKN-----YLCTRRCLPEFCLQY*CCFRSEERRVGKECRSRWSPYH 533 H R F GR N +L T L E C RSEERRVGKECRSRWSPYH Sbjct: 47 HARNFKGRFNSLVAGFLETGETLEE-------CVRSEERRVGKECRSRWSPYH 92 >ref|WP_073495640.1| hypothetical protein [Enterococcus faecalis] Length = 97 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/37 (70%), Positives = 34/37 (91%), Gaps = 2/37 (5%) Frame = -1 Query: 539 FLMIRRPPRSTLFPYTTLFRSEAALV--LQAKLRQAS 435 FLMIRRPPRSTLFPYTTLFRS++A+V +Q++L Q++ Sbjct: 14 FLMIRRPPRSTLFPYTTLFRSKSAIVGIVQSQLDQSN 50