BLASTX nr result
ID: Cheilocostus21_contig00000835
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00000835 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009416958.1| PREDICTED: amino acid permease 6 [Musa acumi... 74 2e-12 ref|XP_017697688.1| PREDICTED: amino acid permease 6-like isofor... 71 3e-11 ref|XP_008786489.1| PREDICTED: amino acid permease 6-like isofor... 71 3e-11 ref|XP_010911645.1| PREDICTED: amino acid permease 8 [Elaeis gui... 69 1e-10 ref|XP_009406478.2| PREDICTED: amino acid permease 8-like [Musa ... 68 2e-10 ref|XP_008795251.1| PREDICTED: amino acid permease 6-like [Phoen... 65 3e-09 ref|XP_015618304.1| PREDICTED: amino acid permease 6 [Oryza sati... 63 2e-08 ref|XP_015698432.1| PREDICTED: amino acid permease 6-like isofor... 63 2e-08 gb|EAZ19917.1| hypothetical protein OsJ_35510 [Oryza sativa Japo... 63 2e-08 ref|XP_003578803.1| PREDICTED: amino acid permease 6-like [Brach... 63 2e-08 ref|XP_015698430.1| PREDICTED: amino acid permease 6-like isofor... 63 2e-08 ref|XP_020406504.1| amino acid permease 6 [Zea mays] 61 5e-08 gb|ONM33799.1| Amino acid permease 6 [Zea mays] 61 5e-08 gb|OEL30018.1| Amino acid permease 6 [Dichanthelium oligosanthes] 60 1e-07 ref|XP_004977155.1| amino acid permease 6 [Setaria italica] >gi|... 60 2e-07 gb|PAN16335.1| hypothetical protein PAHAL_C00674 [Panicum hallii] 60 2e-07 ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vini... 59 3e-07 ref|XP_002441965.1| amino acid permease 6 [Sorghum bicolor] >gi|... 59 5e-07 gb|ACF84729.1| unknown [Zea mays] 58 9e-07 ref|NP_001147944.1| AAP6 [Zea mays] >gi|195614738|gb|ACG29199.1|... 58 1e-06 >ref|XP_009416958.1| PREDICTED: amino acid permease 6 [Musa acuminata subsp. malaccensis] Length = 463 Score = 73.9 bits (180), Expect = 2e-12 Identities = 35/41 (85%), Positives = 37/41 (90%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWFALQ LSFFCLLVS+AAS+GSVADIV NLK APFKTVY Sbjct: 423 KWFALQGLSFFCLLVSVAASIGSVADIVHNLKAAAPFKTVY 463 >ref|XP_017697688.1| PREDICTED: amino acid permease 6-like isoform X2 [Phoenix dactylifera] Length = 452 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWF LQ LSF CLL+S+AAS+GSVADIVRNLK APFKTVY Sbjct: 412 KWFLLQGLSFLCLLISLAASIGSVADIVRNLKVAAPFKTVY 452 >ref|XP_008786489.1| PREDICTED: amino acid permease 6-like isoform X1 [Phoenix dactylifera] Length = 457 Score = 70.9 bits (172), Expect = 3e-11 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWF LQ LSF CLL+S+AAS+GSVADIVRNLK APFKTVY Sbjct: 417 KWFLLQGLSFLCLLISLAASIGSVADIVRNLKVAAPFKTVY 457 >ref|XP_010911645.1| PREDICTED: amino acid permease 8 [Elaeis guineensis] Length = 457 Score = 68.9 bits (167), Expect = 1e-10 Identities = 32/41 (78%), Positives = 35/41 (85%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWF LQ LSF CLL+S+AAS+GSVADIV NLK APFKTVY Sbjct: 417 KWFLLQGLSFLCLLISLAASIGSVADIVHNLKVAAPFKTVY 457 >ref|XP_009406478.2| PREDICTED: amino acid permease 8-like [Musa acuminata subsp. malaccensis] Length = 494 Score = 68.2 bits (165), Expect = 2e-10 Identities = 32/41 (78%), Positives = 34/41 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWF LQ LSFFC L+SIAAS+GSVADIV NLK APFKT Y Sbjct: 454 KWFLLQGLSFFCFLISIAASIGSVADIVHNLKAAAPFKTSY 494 >ref|XP_008795251.1| PREDICTED: amino acid permease 6-like [Phoenix dactylifera] Length = 457 Score = 65.1 bits (157), Expect = 3e-09 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 KWF LQ LS CLL+SIAA++GS+ADIV NLK APFKTVY Sbjct: 417 KWFLLQGLSLLCLLISIAAAIGSMADIVHNLKVAAPFKTVY 457 >ref|XP_015618304.1| PREDICTED: amino acid permease 6 [Oryza sativa Japonica Group] gb|ABA96080.2| amino acid permease I, putative, expressed [Oryza sativa Japonica Group] dbj|BAF29372.1| Os12g0194900 [Oryza sativa Japonica Group] gb|EAY82537.1| hypothetical protein OsI_37760 [Oryza sativa Indica Group] dbj|BAT16231.1| Os12g0194900 [Oryza sativa Japonica Group] Length = 468 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W++LQ +SF CLL+SIAAS+GSV DIV NLK APFKTV Sbjct: 428 RWWSLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFKTV 467 >ref|XP_015698432.1| PREDICTED: amino acid permease 6-like isoform X2 [Oryza brachyantha] Length = 468 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W++LQ +SF CLL+SIAAS+GSV DIV NLK APFKTV Sbjct: 428 RWWSLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFKTV 467 >gb|EAZ19917.1| hypothetical protein OsJ_35510 [Oryza sativa Japonica Group] Length = 469 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W++LQ +SF CLL+SIAAS+GSV DIV NLK APFKTV Sbjct: 429 RWWSLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFKTV 468 >ref|XP_003578803.1| PREDICTED: amino acid permease 6-like [Brachypodium distachyon] gb|KQJ91917.1| hypothetical protein BRADI_4g40570v3 [Brachypodium distachyon] Length = 471 Score = 62.8 bits (151), Expect = 2e-08 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 KW+ LQ +SF CLL+SIAAS+GSV DIV NLKT PFKTV Sbjct: 431 KWWWLQAMSFVCLLISIAASIGSVQDIVHNLKTATPFKTV 470 >ref|XP_015698430.1| PREDICTED: amino acid permease 6-like isoform X1 [Oryza brachyantha] Length = 475 Score = 62.8 bits (151), Expect = 2e-08 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W++LQ +SF CLL+SIAAS+GSV DIV NLK APFKTV Sbjct: 435 RWWSLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFKTV 474 >ref|XP_020406504.1| amino acid permease 6 [Zea mays] Length = 333 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W+ALQ +SF CLLVSI AS+GSV DIV NLK PFKTV Sbjct: 293 RWWALQAMSFVCLLVSIGASIGSVQDIVHNLKAAVPFKTV 332 >gb|ONM33799.1| Amino acid permease 6 [Zea mays] Length = 335 Score = 61.2 bits (147), Expect = 5e-08 Identities = 28/40 (70%), Positives = 32/40 (80%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTV 352 +W+ALQ +SF CLLVSI AS+GSV DIV NLK PFKTV Sbjct: 295 RWWALQAMSFVCLLVSIGASIGSVQDIVHNLKAAVPFKTV 334 >gb|OEL30018.1| Amino acid permease 6 [Dichanthelium oligosanthes] Length = 542 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKT 355 +W+ LQ +SF CLL+SIAAS+GSV DIV NLK APFKT Sbjct: 502 RWWMLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFKT 540 >ref|XP_004977155.1| amino acid permease 6 [Setaria italica] gb|KQK99377.1| hypothetical protein SETIT_010023mg [Setaria italica] Length = 470 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKT 355 +W+ LQ +SF CLL+S+AAS+GSV DIV NLK APFKT Sbjct: 430 RWWMLQAMSFVCLLISVAASIGSVQDIVHNLKAAAPFKT 468 >gb|PAN16335.1| hypothetical protein PAHAL_C00674 [Panicum hallii] Length = 473 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKT 355 +W+ LQ +SF CLL+S+AAS+GSV DIV NLK APFKT Sbjct: 433 RWWMLQAMSFVCLLISVAASIGSVQDIVHNLKAAAPFKT 471 >ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera] emb|CBI37884.3| unnamed protein product, partial [Vitis vinifera] Length = 512 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKTVY 349 +W ALQ+LSF CLL+S+AA+VGSVA +V +LKT PFKT Y Sbjct: 472 RWVALQILSFACLLISLAAAVGSVAGVVLDLKTYKPFKTSY 512 >ref|XP_002441965.1| amino acid permease 6 [Sorghum bicolor] gb|EES15803.1| hypothetical protein SORBI_3008G068200 [Sorghum bicolor] Length = 481 Score = 58.5 bits (140), Expect = 5e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFK 358 +W+ LQ +SF CLL+SIAAS+GSV DIV NLK APFK Sbjct: 441 RWWLLQAMSFVCLLISIAASIGSVQDIVHNLKAAAPFK 478 >gb|ACF84729.1| unknown [Zea mays] Length = 361 Score = 57.8 bits (138), Expect = 9e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKT 355 +W+ LQ +SF CLL+S+AAS+GSV DIV NLK APF T Sbjct: 321 RWWMLQAMSFVCLLISVAASIGSVHDIVHNLKAAAPFNT 359 >ref|NP_001147944.1| AAP6 [Zea mays] gb|ACG29199.1| AAP6 [Zea mays] Length = 483 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 471 KWFALQVLSFFCLLVSIAASVGSVADIVRNLKTVAPFKT 355 +W+ LQ +SF CLL+S+AAS+GSV DIV NLK APF T Sbjct: 443 RWWMLQAMSFVCLLISVAASIGSVHDIVHNLKAAAPFNT 481