BLASTX nr result
ID: Cheilocostus21_contig00000523
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00000523 (1618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78878.1| hypothetical protein (mitochondrion) [Vicia faba]... 121 2e-29 gb|AFK42885.1| unknown [Lotus japonicus] 119 7e-29 ref|XP_020693063.1| uncharacterized protein LOC110107211 [Dendro... 89 2e-17 ref|XP_020596502.1| uncharacterized protein LOC110036406 [Phalae... 88 3e-17 ref|XP_009385757.1| PREDICTED: uncharacterized protein LOC103973... 59 1e-16 gb|ABA99282.1| ATP synthase subunit C family protein [Oryza sati... 80 1e-12 ref|YP_003433850.1| ATP synthase F0 subunit 9 (mitochondrion) [O... 74 5e-12 pir||S59550 H+-transporting two-sector ATPase (EC 3.6.3.14) chai... 68 1e-10 gb|ABE72969.1| ATPase (mitochondrion) [Camellia sinensis] 67 2e-10 gb|ACU30263.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 8e-10 gb|ABV25303.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 8e-10 gb|ABV25274.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 8e-10 gb|ABV25236.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 8e-10 gb|ABV25234.1| ATP synthase subunit 9, partial (mitochondrion) [... 65 8e-10 gb|AAW30248.1| ATP synthase F0 subunit 9, partial (mitochondrion... 65 8e-10 gb|AAW30242.1| ATP synthase F0 subunit 9, partial (mitochondrion... 65 8e-10 gb|EEF22810.1| ATP synthase 9 mitochondrial, putative, partial [... 65 9e-10 ref|XP_013596144.1| PREDICTED: ATP synthase subunit 9, mitochond... 66 9e-10 emb|CDY72393.1| BnaAnng40960D [Brassica napus] 66 9e-10 gb|KRX85853.1| ATP synthase subunit 9, mitochondrial, partial [T... 65 1e-09 >gb|AGC78878.1| hypothetical protein (mitochondrion) [Vicia faba] gb|AGC78917.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 90 Score = 121 bits (303), Expect = 2e-29 Identities = 54/73 (73%), Positives = 62/73 (84%) Frame = +2 Query: 1256 SSRDVRRSKINRCRSCYNCFSRSCCRYWKRLQFLDSFRSAKSIIG*TIIWLCHFGLCSHR 1435 S RDVRR KINRCRSCYNCFS SCCRYWKR+QF++SFR KSIIG T+I +C+ GLCS+R Sbjct: 9 SIRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKTVIRICNPGLCSNR 68 Query: 1436 SYCIVCPNDGLFD 1474 YC+V NDGLFD Sbjct: 69 GYCLVRINDGLFD 81 >gb|AFK42885.1| unknown [Lotus japonicus] Length = 90 Score = 119 bits (299), Expect = 7e-29 Identities = 54/80 (67%), Positives = 62/80 (77%) Frame = +2 Query: 1235 KSVTSKLSSRDVRRSKINRCRSCYNCFSRSCCRYWKRLQFLDSFRSAKSIIG*TIIWLCH 1414 K S RDVRR KINRCRSCYNCFS SCCRYWKR+QF++SFR KSIIG +I +C+ Sbjct: 2 KERDDSFSIRDVRRCKINRCRSCYNCFSGSCCRYWKRIQFINSFRGKKSIIGKAVIRICN 61 Query: 1415 FGLCSHRSYCIVCPNDGLFD 1474 GLCS+R YC+V NDGLFD Sbjct: 62 PGLCSNRGYCLVRINDGLFD 81 >ref|XP_020693063.1| uncharacterized protein LOC110107211 [Dendrobium catenatum] Length = 142 Score = 89.4 bits (220), Expect = 2e-17 Identities = 55/84 (65%), Positives = 55/84 (65%), Gaps = 1/84 (1%) Frame = +3 Query: 1188 GGEEESTKNPGKSSEGKA*R-ANYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIH 1364 GG EESTKNPGKS EGKA R N RLEMLE NVFSSLIH Sbjct: 27 GGAEESTKNPGKS-EGKAKRDENSRLEMLEGAKSMGAGAATIASAGAAVGIGNVFSSLIH 85 Query: 1365 SVARNPSLAKQLFGYAILGFALTE 1436 SVARNPSLAKQ FGYAILGFALTE Sbjct: 86 SVARNPSLAKQSFGYAILGFALTE 109 >ref|XP_020596502.1| uncharacterized protein LOC110036406 [Phalaenopsis equestris] Length = 109 Score = 87.8 bits (216), Expect = 3e-17 Identities = 54/84 (64%), Positives = 55/84 (65%), Gaps = 1/84 (1%) Frame = +3 Query: 1188 GGEEESTKNPGKSSEGKA*R-ANYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIH 1364 GG EESTKNPG +SEGKA R N RLEMLE NVFSSLIH Sbjct: 10 GGAEESTKNPG-NSEGKAKRDENSRLEMLEGAKSMGAGAATIASAGAAVGIGNVFSSLIH 68 Query: 1365 SVARNPSLAKQLFGYAILGFALTE 1436 SVARNPSLAKQ FGYAILGFALTE Sbjct: 69 SVARNPSLAKQSFGYAILGFALTE 92 >ref|XP_009385757.1| PREDICTED: uncharacterized protein LOC103973025 [Musa acuminata subsp. malaccensis] Length = 120 Score = 58.9 bits (141), Expect(2) = 1e-16 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +1 Query: 1162 VNYSTMDRGVGKRNRRRIQERAAKEKRDEQIIV 1260 +NY+ MDRGVGKRNRRRIQERA KEKRDE I+V Sbjct: 3 LNYTIMDRGVGKRNRRRIQERAVKEKRDESILV 35 Score = 58.2 bits (139), Expect(2) = 1e-16 Identities = 34/59 (57%), Positives = 35/59 (59%) Frame = +3 Query: 1260 LEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 LEMLE NV SS I+SVARNPSLAKQLFGYAILGFALTE Sbjct: 37 LEMLEGAKSIGAGAATIASAGAAVGIGNVLSSSINSVARNPSLAKQLFGYAILGFALTE 95 >gb|ABA99282.1| ATP synthase subunit C family protein [Oryza sativa Japonica Group] Length = 354 Score = 80.5 bits (197), Expect = 1e-12 Identities = 57/148 (38%), Positives = 63/148 (42%) Frame = +3 Query: 1173 YYGSRGGEEESTKNPGKSSEGKA*RANYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFS 1352 YYG R G E + + + + RL+MLE NV S Sbjct: 114 YYGPRRGINEKPRKELRKKSVTSKVKSPRLDMLEGAKSIGAGAATIALAGAAVGIGNVLS 173 Query: 1353 SLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXSLKYGLFISWCSPP 1532 S IHSVARNPSLAKQLFGYAILGFALTE S + ISWC Sbjct: 174 SSIHSVARNPSLAKQLFGYAILGFALTE-----AIALFAPMMAFLISFVFRSHISWCRYL 228 Query: 1533 SHXXXXXXXXXXXXAMGGKKSGYAGFFH 1616 S GGKKSG GFFH Sbjct: 229 SLQIEIPRPPNLLVVGGGKKSGNVGFFH 256 >ref|YP_003433850.1| ATP synthase F0 subunit 9 (mitochondrion) [Oryza rufipogon] ref|XP_015618889.1| PREDICTED: ATP synthase subunit 9, mitochondrial [Oryza sativa Japonica Group] dbj|BAI67954.1| ATP synthase F0 subunit 9 (mitochondrion) [Oryza rufipogon] Length = 127 Score = 73.6 bits (179), Expect = 5e-12 Identities = 46/92 (50%), Positives = 47/92 (51%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTEXXXXXXXXXXXXXXXXXXSLKYGLFISW 1520 NV SS IHSVARNPSLAKQLFGYAILGFALTE S + ISW Sbjct: 26 NVLSSSIHSVARNPSLAKQLFGYAILGFALTE-----AIALFAPMMAFLISFVFRSHISW 80 Query: 1521 CSPPSHXXXXXXXXXXXXAMGGKKSGYAGFFH 1616 C S GGKKSG GFFH Sbjct: 81 CRYLSLQIEIPRPPNLLVVGGGKKSGNVGFFH 112 >pir||S59550 H+-transporting two-sector ATPase (EC 3.6.3.14) chain 9.1 - radish mitochondrion Length = 85 Score = 68.2 bits (165), Expect = 1e-10 Identities = 38/62 (61%), Positives = 39/62 (62%) Frame = +3 Query: 1251 NYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQLFGYAILGFAL 1430 NY+ EMLE NVFSSLIHSVARNPSLAKQLFGYAILGFAL Sbjct: 7 NYQPEMLEGAKLIGAGAATIALAGAAIGIGNVFSSLIHSVARNPSLAKQLFGYAILGFAL 66 Query: 1431 TE 1436 TE Sbjct: 67 TE 68 >gb|ABE72969.1| ATPase (mitochondrion) [Camellia sinensis] Length = 85 Score = 67.4 bits (163), Expect = 2e-10 Identities = 38/62 (61%), Positives = 39/62 (62%) Frame = +3 Query: 1251 NYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQLFGYAILGFAL 1430 N +LEMLE NVFSSLIHSVARNPSLAKQLFGYAILGFAL Sbjct: 7 NSQLEMLEGAKLMGAGAATIALAGAAVGIGNVFSSLIHSVARNPSLAKQLFGYAILGFAL 66 Query: 1431 TE 1436 TE Sbjct: 67 TE 68 >gb|ACU30263.1| ATP synthase subunit 9, partial (mitochondrion) [Silene delicatula] gb|ACU30281.1| ATP synthase subunit 9, partial (mitochondrion) [Silene nana] Length = 56 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25303.1| ATP synthase subunit 9, partial (mitochondrion) [Silene noctiflora] gb|ACU30254.1| ATP synthase subunit 9, partial (mitochondrion) [Silene ammophila] gb|ACU30260.1| ATP synthase subunit 9, partial (mitochondrion) [Silene conica] gb|ACU30268.1| ATP synthase subunit 9, partial (mitochondrion) [Silene gallinyi] gb|ACU30270.1| ATP synthase subunit 9, partial (mitochondrion) [Silene imbricata] gb|ACU30277.1| ATP synthase subunit 9, partial (mitochondrion) [Silene macrodonta] gb|ACU30282.1| ATP synthase subunit 9, partial (mitochondrion) [Silene niceensis] gb|ACU30286.1| ATP synthase subunit 9, partial (mitochondrion) [Silene pygmaea] gb|ACU30290.1| ATP synthase subunit 9, partial (mitochondrion) [Silene schafta] gb|ACU30295.1| ATP synthase subunit 9, partial (mitochondrion) [Silene turkestanica] Length = 56 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25274.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25275.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25276.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25277.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25278.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25279.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25280.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25281.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25282.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25283.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25284.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25285.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25286.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25287.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25288.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25289.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25290.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25291.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25292.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25293.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25294.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25295.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25296.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25297.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25298.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25299.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25300.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ABV25301.1| ATP synthase subunit 9, partial (mitochondrion) [Silene latifolia] gb|ACU30247.1| ATP synthase subunit 9, partial (mitochondrion) [Agrostemma githago] gb|ACU30249.1| ATP synthase subunit 9, partial (mitochondrion) [Silene laeta] gb|ACU30251.1| ATP synthase subunit 9, partial (mitochondrion) [Petrocoptis pyrenaica] gb|ACU30252.1| ATP synthase subunit 9, partial (mitochondrion) [Silene acutifolia] gb|ACU30253.1| ATP synthase subunit 9, partial (mitochondrion) [Silene akinfievii] gb|ACU30261.1| ATP synthase subunit 9, partial (mitochondrion) [Silene cordifolia] gb|ACU30269.1| ATP synthase subunit 9, partial (mitochondrion) [Silene hookeri] gb|ACU30271.1| ATP synthase subunit 9, partial (mitochondrion) [Silene integripetala] gb|ACU30273.1| ATP synthase subunit 9, partial (mitochondrion) [Silene khasiana] gb|ACU30274.1| ATP synthase subunit 9, partial (mitochondrion) [Silene lacera] gb|ACU30278.1| ATP synthase subunit 9, partial (mitochondrion) [Silene menziesii] gb|ACU30292.1| ATP synthase subunit 9, partial (mitochondrion) [Silene sordida] Length = 56 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25236.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ACU30296.1| ATP synthase subunit 9, partial (mitochondrion) [Silene uniflora] Length = 56 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|ABV25234.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25235.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25237.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25238.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25239.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25240.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25242.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25243.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25244.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25245.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25246.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25247.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25248.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25249.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25250.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25251.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25252.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25253.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25254.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25255.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25256.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25258.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25260.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25261.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25262.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25263.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25264.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25265.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25266.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25267.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25268.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25269.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25270.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25271.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25272.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25273.1| ATP synthase subunit 9, partial (mitochondrion) [Silene vulgaris] gb|ABV25302.1| ATP synthase subunit 9, partial (mitochondrion) [Silene acaulis] gb|ABV25304.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] gb|ABV25305.1| ATP synthase subunit 9, partial (mitochondrion) [Silene stellata] gb|ABV25306.1| ATP synthase subunit 9, partial (mitochondrion) [Silene coronaria] gb|ACU30248.1| ATP synthase subunit 9, partial (mitochondrion) [Atocion lerchenfeldianum] gb|ACU30250.1| ATP synthase subunit 9, partial (mitochondrion) [Heliosperma pusillum] gb|ACU30256.1| ATP synthase subunit 9, partial (mitochondrion) [Silene argentina] gb|ACU30257.1| ATP synthase subunit 9, partial (mitochondrion) [Silene auriculata] gb|ACU30258.1| ATP synthase subunit 9, partial (mitochondrion) [Silene caesia] gb|ACU30262.1| ATP synthase subunit 9, partial (mitochondrion) [Silene davidii] gb|ACU30264.1| ATP synthase subunit 9, partial (mitochondrion) [Silene dichotoma] gb|ACU30265.1| ATP synthase subunit 9, partial (mitochondrion) [Silene douglasii] gb|ACU30266.1| ATP synthase subunit 9, partial (mitochondrion) [Silene flavescens] gb|ACU30267.1| ATP synthase subunit 9, partial (mitochondrion) [Silene fruticosa] gb|ACU30272.1| ATP synthase subunit 9, partial (mitochondrion) [Silene involucrata] gb|ACU30275.1| ATP synthase subunit 9, partial (mitochondrion) [Silene laciniata] gb|ACU30276.1| ATP synthase subunit 9, partial (mitochondrion) [Silene littorea] gb|ACU30279.1| ATP synthase subunit 9, partial (mitochondrion) [Silene multicaulis] gb|ACU30280.1| ATP synthase subunit 9, partial (mitochondrion) [Silene muscipula] gb|ACU30283.1| ATP synthase subunit 9, partial (mitochondrion) [Silene odontopetala] gb|ACU30284.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paradoxa] gb|ACU30285.1| ATP synthase subunit 9, partial (mitochondrion) [Silene paucifolia] gb|ACU30288.1| ATP synthase subunit 9, partial (mitochondrion) [Silene sachalinensis] gb|ACU30291.1| ATP synthase subunit 9, partial (mitochondrion) [Silene seoulensis] gb|ACU30298.1| ATP synthase subunit 9, partial (mitochondrion) [Silene yemensis] gb|ACU30299.1| ATP synthase subunit 9, partial (mitochondrion) [Silene zawadskii] gb|ACU30300.1| ATP synthase subunit 9, partial (mitochondrion) [Viscaria alpina] Length = 56 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|AAW30248.1| ATP synthase F0 subunit 9, partial (mitochondrion) [Aloe vera] Length = 59 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|AAW30242.1| ATP synthase F0 subunit 9, partial (mitochondrion) [Piper betle] Length = 59 Score = 65.1 bits (157), Expect = 8e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 18 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 49 >gb|EEF22810.1| ATP synthase 9 mitochondrial, putative, partial [Ricinus communis] Length = 61 Score = 65.1 bits (157), Expect = 9e-10 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 26 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 57 >ref|XP_013596144.1| PREDICTED: ATP synthase subunit 9, mitochondrial [Brassica oleracea var. oleracea] emb|CDY45507.1| BnaCnng12660D [Brassica napus] Length = 85 Score = 65.9 bits (159), Expect = 9e-10 Identities = 37/62 (59%), Positives = 38/62 (61%) Frame = +3 Query: 1251 NYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQLFGYAILGFAL 1430 NY+ EMLE NVFSSLIHSVARNPSLAKQ FGYAILGFAL Sbjct: 7 NYQPEMLEGAKSIGAGAATIASAGAAIGIGNVFSSLIHSVARNPSLAKQSFGYAILGFAL 66 Query: 1431 TE 1436 TE Sbjct: 67 TE 68 >emb|CDY72393.1| BnaAnng40960D [Brassica napus] Length = 85 Score = 65.9 bits (159), Expect = 9e-10 Identities = 37/62 (59%), Positives = 38/62 (61%) Frame = +3 Query: 1251 NYRLEMLEXXXXXXXXXXXXXXXXXXXXXXNVFSSLIHSVARNPSLAKQLFGYAILGFAL 1430 NY+ EMLE NVFSSLIHSVARNPSLAKQ FGYAILGFAL Sbjct: 7 NYQPEMLEGAKSIGVGAATIASAGAAISIGNVFSSLIHSVARNPSLAKQSFGYAILGFAL 66 Query: 1431 TE 1436 TE Sbjct: 67 TE 68 >gb|KRX85853.1| ATP synthase subunit 9, mitochondrial, partial [Trichinella patagoniensis] Length = 65 Score = 65.1 bits (157), Expect = 1e-09 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +3 Query: 1341 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 1436 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE Sbjct: 19 NVFSSLIHSVARNPSLAKQLFGYAILGFALTE 50