BLASTX nr result
ID: Cheilocostus21_contig00000278
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cheilocostus21_contig00000278 (997 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OAY80436.1| Small ubiquitin-related modifier 2 [Ananas comosus] 188 1e-56 ref|XP_009412743.1| PREDICTED: small ubiquitin-related modifier ... 188 2e-56 ref|XP_020089457.1| small ubiquitin-related modifier 1 [Ananas c... 187 3e-56 ref|XP_020081913.1| small ubiquitin-related modifier 1-like [Ana... 187 3e-56 ref|XP_010927676.1| PREDICTED: small ubiquitin-related modifier ... 186 5e-56 ref|XP_008794618.1| PREDICTED: small ubiquitin-related modifier ... 185 1e-55 ref|XP_020260975.1| small ubiquitin-related modifier 2 [Asparagu... 184 4e-55 ref|XP_008775626.1| PREDICTED: small ubiquitin-related modifier ... 184 4e-55 ref|XP_009411857.1| PREDICTED: small ubiquitin-related modifier ... 184 5e-55 ref|XP_020248219.1| small ubiquitin-related modifier 1 [Asparagu... 182 1e-54 ref|XP_008794940.1| PREDICTED: small ubiquitin-related modifier ... 182 2e-54 ref|XP_009402741.1| PREDICTED: small ubiquitin-related modifier ... 180 2e-53 ref|XP_010929803.1| PREDICTED: small ubiquitin-related modifier ... 180 2e-53 ref|XP_022771472.1| small ubiquitin-related modifier 1-like [Dur... 180 2e-53 ref|XP_022727775.1| small ubiquitin-related modifier 1-like [Dur... 179 5e-53 ref|XP_011095446.1| small ubiquitin-related modifier 1 [Sesamum ... 177 1e-52 ref|XP_010926757.2| PREDICTED: small ubiquitin-related modifier ... 178 1e-52 ref|XP_006836459.1| small ubiquitin-related modifier 2 isoform X... 177 1e-52 ref|XP_012085087.1| small ubiquitin-related modifier 1 [Jatropha... 177 2e-52 ref|XP_020688570.1| small ubiquitin-related modifier 2-like [Den... 177 2e-52 >gb|OAY80436.1| Small ubiquitin-related modifier 2 [Ananas comosus] Length = 99 Score = 188 bits (477), Expect = 1e-56 Identities = 92/92 (100%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_009412743.1| PREDICTED: small ubiquitin-related modifier 1 [Musa acuminata subsp. malaccensis] Length = 108 Score = 188 bits (477), Expect = 2e-56 Identities = 92/92 (100%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_020089457.1| small ubiquitin-related modifier 1 [Ananas comosus] gb|OAY72068.1| Small ubiquitin-related modifier 2 [Ananas comosus] Length = 99 Score = 187 bits (474), Expect = 3e-56 Identities = 91/92 (98%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_020081913.1| small ubiquitin-related modifier 1-like [Ananas comosus] ref|XP_020103347.1| small ubiquitin-related modifier 1-like [Ananas comosus] gb|OAY67727.1| Small ubiquitin-related modifier 2 [Ananas comosus] Length = 99 Score = 187 bits (474), Expect = 3e-56 Identities = 91/92 (98%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQ+EDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQDEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_010927676.1| PREDICTED: small ubiquitin-related modifier 1-like [Elaeis guineensis] Length = 103 Score = 186 bits (473), Expect = 5e-56 Identities = 91/92 (98%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTP+ELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPEELEMEDGDEIDAMLHQT 92 >ref|XP_008794618.1| PREDICTED: small ubiquitin-related modifier 1-like [Phoenix dactylifera] Length = 103 Score = 185 bits (470), Expect = 1e-55 Identities = 90/92 (97%), Positives = 92/92 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQ+AHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTP+ELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPEELEMEDGDEIDAMLHQT 92 >ref|XP_020260975.1| small ubiquitin-related modifier 2 [Asparagus officinalis] Length = 98 Score = 184 bits (467), Expect = 4e-55 Identities = 90/92 (97%), Positives = 90/92 (97%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAG EEDKKPADQ AHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGAEEDKKPADQGAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_008775626.1| PREDICTED: small ubiquitin-related modifier 2-like [Phoenix dactylifera] ref|XP_010913055.1| PREDICTED: small ubiquitin-related modifier 2 [Elaeis guineensis] Length = 102 Score = 184 bits (467), Expect = 4e-55 Identities = 90/92 (97%), Positives = 91/92 (98%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGA QEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAAQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEME+GDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEEGDEIDAMLHQT 92 >ref|XP_009411857.1| PREDICTED: small ubiquitin-related modifier 2-like [Musa acuminata subsp. malaccensis] Length = 99 Score = 184 bits (466), Expect = 5e-55 Identities = 89/92 (96%), Positives = 91/92 (98%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSG GQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFN+IA Sbjct: 1 MSGPGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNAIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_020248219.1| small ubiquitin-related modifier 1 [Asparagus officinalis] gb|ONK56232.1| uncharacterized protein A4U43_C10F5480 [Asparagus officinalis] Length = 97 Score = 182 bits (463), Expect = 1e-54 Identities = 89/92 (96%), Positives = 90/92 (97%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAG EEDKKPADQ AHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGTEEDKKPADQGAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEME+GDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEEGDEIDAMLHQT 92 >ref|XP_008794940.1| PREDICTED: small ubiquitin-related modifier 2-like [Phoenix dactylifera] Length = 102 Score = 182 bits (462), Expect = 2e-54 Identities = 89/92 (96%), Positives = 90/92 (97%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGA QEEDKKPADQ+AHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAAQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_009402741.1| PREDICTED: small ubiquitin-related modifier 2 [Musa acuminata subsp. malaccensis] Length = 99 Score = 180 bits (456), Expect = 2e-53 Identities = 87/92 (94%), Positives = 91/92 (98%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVK QDGNEVFFRIKRSTQLRKLM+AYCDRQS+DFN+IA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKSQDGNEVFFRIKRSTQLRKLMSAYCDRQSMDFNAIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQ+PDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQSPDELEMEDGDEIDAMLHQT 92 >ref|XP_010929803.1| PREDICTED: small ubiquitin-related modifier 2 [Elaeis guineensis] Length = 102 Score = 180 bits (456), Expect = 2e-53 Identities = 88/92 (95%), Positives = 89/92 (96%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MS A QEEDKKPADQ+AHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSAAAQEEDKKPADQAAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLR EQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRAEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_022771472.1| small ubiquitin-related modifier 1-like [Durio zibethinus] Length = 105 Score = 180 bits (456), Expect = 2e-53 Identities = 87/92 (94%), Positives = 89/92 (96%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 + G GQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVD NSIA Sbjct: 7 VGGGGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDMNSIA 66 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 67 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 98 >ref|XP_022727775.1| small ubiquitin-related modifier 1-like [Durio zibethinus] Length = 112 Score = 179 bits (454), Expect = 5e-53 Identities = 87/91 (95%), Positives = 89/91 (97%) Frame = +2 Query: 86 SGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIAF 265 SG GQEED+KPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVD +SIAF Sbjct: 15 SGGGQEEDRKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDMSSIAF 74 Query: 266 LFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 LFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 75 LFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 105 >ref|XP_011095446.1| small ubiquitin-related modifier 1 [Sesamum indicum] ref|XP_011095447.1| small ubiquitin-related modifier 1 [Sesamum indicum] Length = 95 Score = 177 bits (450), Expect = 1e-52 Identities = 86/89 (96%), Positives = 88/89 (98%) Frame = +2 Query: 92 AGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIAFLF 271 +GQEEDKKPAD SAHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVDFNSIAFLF Sbjct: 2 SGQEEDKKPADASAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDFNSIAFLF 61 Query: 272 DGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 DGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 62 DGRRLRGEQTPDELEMEDGDEIDAMLHQT 90 >ref|XP_010926757.2| PREDICTED: small ubiquitin-related modifier 1 [Elaeis guineensis] Length = 107 Score = 178 bits (451), Expect = 1e-52 Identities = 87/88 (98%), Positives = 88/88 (100%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA Sbjct: 1 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAM 346 FLFDGRRLRGEQTPDELEMEDGDEIDA+ Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAV 88 >ref|XP_006836459.1| small ubiquitin-related modifier 2 isoform X1 [Amborella trichopoda] gb|ERM99312.1| hypothetical protein AMTR_s00228p00023500 [Amborella trichopoda] Length = 98 Score = 177 bits (450), Expect = 1e-52 Identities = 87/92 (94%), Positives = 88/92 (95%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGA EE+KKP DQSAHINLKVKGQDGNEVFFRIKRSTQLRKLM AYCDRQSVDFNSIA Sbjct: 1 MSGATNEEEKKPVDQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMTAYCDRQSVDFNSIA 60 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 61 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 92 >ref|XP_012085087.1| small ubiquitin-related modifier 1 [Jatropha curcas] gb|KDP26374.1| hypothetical protein JCGZ_17532 [Jatropha curcas] Length = 109 Score = 177 bits (450), Expect = 2e-52 Identities = 86/94 (91%), Positives = 88/94 (93%) Frame = +2 Query: 77 VKMSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNS 256 V G GQEEDKKP DQSAHINLKVKGQDGNE+FFRIKRSTQLRKLM AYCDRQSV+FNS Sbjct: 9 VGSGGGGQEEDKKPVDQSAHINLKVKGQDGNEIFFRIKRSTQLRKLMTAYCDRQSVEFNS 68 Query: 257 IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 69 IAFLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 102 >ref|XP_020688570.1| small ubiquitin-related modifier 2-like [Dendrobium catenatum] gb|PKU85797.1| Small ubiquitin-related modifier 2 [Dendrobium catenatum] Length = 101 Score = 177 bits (449), Expect = 2e-52 Identities = 88/92 (95%), Positives = 90/92 (97%) Frame = +2 Query: 83 MSGAGQEEDKKPADQSAHINLKVKGQDGNEVFFRIKRSTQLRKLMNAYCDRQSVDFNSIA 262 MSGAGQEEDKKP DQ+AHINLKVKGQDGNEVFFRIKRSTQL+KLMNAYCDRQSVD NSIA Sbjct: 1 MSGAGQEEDKKP-DQAAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSIA 59 Query: 263 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 358 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT Sbjct: 60 FLFDGRRLRGEQTPDELEMEDGDEIDAMLHQT 91