BLASTX nr result
ID: Cephaelis21_contig00054469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054469 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAY14574.1| oleosin [Coffea arabica] 61 8e-08 gb|AAX49389.1| OLE-1 [Coffea canephora] 61 8e-08 >gb|AAY14574.1| oleosin [Coffea arabica] Length = 148 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 3 VNYLRSMKGSLPEHVEQAKWRVQDTAGQVGHKGKEVGQRLQETVRS 140 +NY+R MK S E ++ AKWRVQDTAGQVG K ++VGQR Q+ R+ Sbjct: 103 LNYIRLMKASSQEQMDLAKWRVQDTAGQVGQKARDVGQRTQDVARA 148 >gb|AAX49389.1| OLE-1 [Coffea canephora] Length = 148 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = +3 Query: 3 VNYLRSMKGSLPEHVEQAKWRVQDTAGQVGHKGKEVGQRLQETVRS 140 +NY+R MK S E ++ AKWRVQDTAGQVG K ++VGQR Q+ R+ Sbjct: 103 LNYIRLMKASSQEQMDLAKWRVQDTAGQVGQKARDVGQRTQDVARA 148