BLASTX nr result
ID: Cephaelis21_contig00054336
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054336 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596210.1| hypothetical protein MTR_2g071600 [Medicago ... 60 2e-07 >ref|XP_003596210.1| hypothetical protein MTR_2g071600 [Medicago truncatula] gi|355485258|gb|AES66461.1| hypothetical protein MTR_2g071600 [Medicago truncatula] Length = 371 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/69 (39%), Positives = 43/69 (62%) Frame = +2 Query: 11 VL*GRPWLFENRLLVLHHWSEDLNWKDSCFSRSPLWV*IYNVPSHWLSIDTGKRIGKRLG 190 +L G PW+ N L++H W +N K+ FS+ PLWV ++ +P H SI G++IG ++G Sbjct: 172 ILKGNPWIICNCWLIIHAWDRKVNPKELDFSKVPLWVQLWGLPLHCKSIMIGEQIGSQIG 231 Query: 191 KVRNVLLVE 217 +V + L E Sbjct: 232 QVLDTSLYE 240