BLASTX nr result
ID: Cephaelis21_contig00054245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054245 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003528491.1| PREDICTED: C2 and GRAM domain-containing pro... 98 8e-19 ref|XP_003518872.1| PREDICTED: C2 and GRAM domain-containing pro... 96 2e-18 ref|XP_003608068.1| GRAM domain-containing protein [Medicago tru... 95 5e-18 ref|XP_002330652.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-17 ref|XP_002878285.1| C2 domain-containing protein [Arabidopsis ly... 89 4e-16 >ref|XP_003528491.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 585 Score = 97.8 bits (242), Expect = 8e-19 Identities = 42/49 (85%), Positives = 43/49 (87%) Frame = +3 Query: 15 LQMGQWHTTDEYDGQVREIKFRSLCNSPMCPPDTVVTEWQHHVLPSDKK 161 L MGQWHT DEYDGQVREI FRSLCNSPMCPPDT +TEWQHHVL DKK Sbjct: 437 LVMGQWHTADEYDGQVREITFRSLCNSPMCPPDTAMTEWQHHVLSLDKK 485 >ref|XP_003518872.1| PREDICTED: C2 and GRAM domain-containing protein At1g03370-like [Glycine max] Length = 584 Score = 96.3 bits (238), Expect = 2e-18 Identities = 41/48 (85%), Positives = 42/48 (87%) Frame = +3 Query: 15 LQMGQWHTTDEYDGQVREIKFRSLCNSPMCPPDTVVTEWQHHVLPSDK 158 L MGQWHT DEYDGQVREI FRSLCNSPMCPPDT +TEWQHHVL DK Sbjct: 435 LLMGQWHTADEYDGQVREITFRSLCNSPMCPPDTAMTEWQHHVLSPDK 482 >ref|XP_003608068.1| GRAM domain-containing protein [Medicago truncatula] gi|355509123|gb|AES90265.1| GRAM domain-containing protein [Medicago truncatula] Length = 582 Score = 95.1 bits (235), Expect = 5e-18 Identities = 41/49 (83%), Positives = 43/49 (87%) Frame = +3 Query: 15 LQMGQWHTTDEYDGQVREIKFRSLCNSPMCPPDTVVTEWQHHVLPSDKK 161 L MGQWHT +EYDGQVREI FRSLCNSPMCPPDT +TEWQH VL SDKK Sbjct: 434 LVMGQWHTAEEYDGQVREITFRSLCNSPMCPPDTAITEWQHVVLSSDKK 482 >ref|XP_002330652.1| predicted protein [Populus trichocarpa] gi|222872256|gb|EEF09387.1| predicted protein [Populus trichocarpa] Length = 590 Score = 94.0 bits (232), Expect = 1e-17 Identities = 41/49 (83%), Positives = 41/49 (83%) Frame = +3 Query: 15 LQMGQWHTTDEYDGQVREIKFRSLCNSPMCPPDTVVTEWQHHVLPSDKK 161 L MGQWH DEYDGQVREI FRSLCNSPMCPPDT VTEWQH VL DKK Sbjct: 440 LVMGQWHAADEYDGQVREITFRSLCNSPMCPPDTAVTEWQHFVLSPDKK 488 >ref|XP_002878285.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297324123|gb|EFH54544.1| C2 domain-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 586 Score = 89.0 bits (219), Expect = 4e-16 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +3 Query: 15 LQMGQWHTTDEYDGQVREIKFRSLCNSPMCPPDTVVTEWQHHVLPSDKK 161 L + WHT +EYDGQVREIKFRS+CNSPMCPPDT VTEWQH VL DKK Sbjct: 443 LNIEPWHTAEEYDGQVREIKFRSICNSPMCPPDTAVTEWQHVVLSPDKK 491