BLASTX nr result
ID: Cephaelis21_contig00054141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00054141 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002308934.1| predicted protein [Populus trichocarpa] gi|2... 143 2e-32 ref|XP_003553405.1| PREDICTED: kinesin-4-like [Glycine max] 140 1e-31 ref|XP_003625129.1| Kinesin-like polypeptide [Medicago truncatul... 139 3e-31 ref|XP_003520514.1| PREDICTED: kinesin-4-like [Glycine max] 138 4e-31 ref|NP_187642.4| myosin and kinesin motor and CH domain-containi... 136 2e-30 >ref|XP_002308934.1| predicted protein [Populus trichocarpa] gi|222854910|gb|EEE92457.1| predicted protein [Populus trichocarpa] Length = 924 Score = 143 bits (360), Expect = 2e-32 Identities = 65/87 (74%), Positives = 76/87 (87%) Frame = -2 Query: 266 VGEKRGNIRVYCRIRPLFRSETKSVIDFIGEDGSLVVTDPLKPLKDGRKVFEFNRAFGPT 87 V + +GNIRVYCRIRP F T +VID+IG+DGSLV++DPLKP KDG+KVF+FNR FGPT Sbjct: 312 VQDLKGNIRVYCRIRPAFGDRTSNVIDYIGDDGSLVISDPLKPQKDGKKVFQFNRVFGPT 371 Query: 86 ATQDDVFADTRPLIRSVMDGYNACIFA 6 ATQD+VF DT+PLIRSVMDGYN CIFA Sbjct: 372 ATQDEVFMDTQPLIRSVMDGYNVCIFA 398 >ref|XP_003553405.1| PREDICTED: kinesin-4-like [Glycine max] Length = 989 Score = 140 bits (352), Expect = 1e-31 Identities = 64/87 (73%), Positives = 75/87 (86%) Frame = -2 Query: 266 VGEKRGNIRVYCRIRPLFRSETKSVIDFIGEDGSLVVTDPLKPLKDGRKVFEFNRAFGPT 87 V + +GNIRVYCRIRP FR+E+K+V+DFIGEDG L + DP K LKDGRKVF+FNR FGPT Sbjct: 377 VQDLKGNIRVYCRIRPSFRAESKNVVDFIGEDGYLFILDPTKTLKDGRKVFQFNRVFGPT 436 Query: 86 ATQDDVFADTRPLIRSVMDGYNACIFA 6 A QD+V+ DT+PLIRSVMDGYN CIFA Sbjct: 437 ADQDEVYKDTQPLIRSVMDGYNVCIFA 463 >ref|XP_003625129.1| Kinesin-like polypeptide [Medicago truncatula] gi|355500144|gb|AES81347.1| Kinesin-like polypeptide [Medicago truncatula] Length = 1012 Score = 139 bits (349), Expect = 3e-31 Identities = 64/87 (73%), Positives = 75/87 (86%) Frame = -2 Query: 266 VGEKRGNIRVYCRIRPLFRSETKSVIDFIGEDGSLVVTDPLKPLKDGRKVFEFNRAFGPT 87 V + +GNIRVYCRIRP FR+E+K+V DFIGEDGSL + DP K LKDGRK+F+FNR FGPT Sbjct: 366 VQDLKGNIRVYCRIRPTFRAESKTVTDFIGEDGSLCILDPSKTLKDGRKLFQFNRIFGPT 425 Query: 86 ATQDDVFADTRPLIRSVMDGYNACIFA 6 A QD+V+ DT+PLIRSVMDGYN CIFA Sbjct: 426 AGQDEVYRDTQPLIRSVMDGYNVCIFA 452 >ref|XP_003520514.1| PREDICTED: kinesin-4-like [Glycine max] Length = 990 Score = 138 bits (348), Expect = 4e-31 Identities = 63/87 (72%), Positives = 75/87 (86%) Frame = -2 Query: 266 VGEKRGNIRVYCRIRPLFRSETKSVIDFIGEDGSLVVTDPLKPLKDGRKVFEFNRAFGPT 87 V + +GNIRVYCRIRP FR+E+K+V+DFIGEDGSL + DP K LKDGRK+F+FN+ FGP Sbjct: 378 VQDLKGNIRVYCRIRPSFRAESKNVVDFIGEDGSLFILDPTKTLKDGRKLFQFNQVFGPI 437 Query: 86 ATQDDVFADTRPLIRSVMDGYNACIFA 6 A QDDV+ DT+PLIRSVMDGYN CIFA Sbjct: 438 AGQDDVYKDTQPLIRSVMDGYNVCIFA 464 >ref|NP_187642.4| myosin and kinesin motor and CH domain-containing protein [Arabidopsis thaliana] gi|332641369|gb|AEE74890.1| myosin and kinesin motor and CH domain-containing protein [Arabidopsis thaliana] Length = 922 Score = 136 bits (342), Expect = 2e-30 Identities = 62/87 (71%), Positives = 72/87 (82%) Frame = -2 Query: 266 VGEKRGNIRVYCRIRPLFRSETKSVIDFIGEDGSLVVTDPLKPLKDGRKVFEFNRAFGPT 87 V + +GNIRVYCR+RP+F SE VID+IG+DGSL V DP KP KD RK F+FN+ FGPT Sbjct: 357 VQDLKGNIRVYCRVRPIFNSEMDGVIDYIGKDGSLFVLDPSKPYKDARKTFQFNQVFGPT 416 Query: 86 ATQDDVFADTRPLIRSVMDGYNACIFA 6 ATQDDVF +T+PLIRSVMDGYN CIFA Sbjct: 417 ATQDDVFRETQPLIRSVMDGYNVCIFA 443