BLASTX nr result
ID: Cephaelis21_contig00053000
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00053000 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002337878.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002335114.1| predicted protein [Populus trichocarpa] gi|2... 87 1e-15 ref|XP_002303344.1| predicted protein [Populus trichocarpa] gi|2... 85 5e-15 ref|XP_003543877.1| PREDICTED: polygalacturonase QRT3-like [Glyc... 84 9e-15 gb|ADN34218.1| polygalacturonase [Cucumis melo subsp. melo] 82 5e-14 >ref|XP_002337878.1| predicted protein [Populus trichocarpa] gi|222869958|gb|EEF07089.1| predicted protein [Populus trichocarpa] Length = 336 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/61 (62%), Positives = 51/61 (83%) Frame = +3 Query: 9 LDFNPILLFPDFVKHVQYTFSTSGSSFPNHALRNVSKNNVVIESDVPIQATVFVLVDQGK 188 +DF+P+LLFP+ + HVQY+ S+SG+ FP+HALRNVS+N VVIESD+ + A VFV V+QG Sbjct: 275 VDFSPVLLFPNLINHVQYSLSSSGTKFPSHALRNVSQNRVVIESDIAVAARVFVTVEQGS 334 Query: 189 T 191 T Sbjct: 335 T 335 >ref|XP_002335114.1| predicted protein [Populus trichocarpa] gi|224137804|ref|XP_002326444.1| predicted protein [Populus trichocarpa] gi|222832896|gb|EEE71373.1| predicted protein [Populus trichocarpa] gi|222833766|gb|EEE72243.1| predicted protein [Populus trichocarpa] Length = 496 Score = 87.4 bits (215), Expect = 1e-15 Identities = 38/61 (62%), Positives = 51/61 (83%) Frame = +3 Query: 9 LDFNPILLFPDFVKHVQYTFSTSGSSFPNHALRNVSKNNVVIESDVPIQATVFVLVDQGK 188 +DF+P+LLFP+ + HVQY+ S+SG+ FP+HALRNVS+N VVIESD+ + A VFV V+QG Sbjct: 435 VDFSPVLLFPNLINHVQYSLSSSGTKFPSHALRNVSQNRVVIESDIAVAARVFVTVEQGS 494 Query: 189 T 191 T Sbjct: 495 T 495 >ref|XP_002303344.1| predicted protein [Populus trichocarpa] gi|222840776|gb|EEE78323.1| predicted protein [Populus trichocarpa] Length = 489 Score = 85.1 bits (209), Expect = 5e-15 Identities = 38/59 (64%), Positives = 51/59 (86%) Frame = +3 Query: 9 LDFNPILLFPDFVKHVQYTFSTSGSSFPNHALRNVSKNNVVIESDVPIQATVFVLVDQG 185 +DF+P+LLFP+ + HVQY+ S+SG+ FP+HALRNVS+N VVIESDV + A+VFV V+QG Sbjct: 428 IDFSPVLLFPNLIDHVQYSVSSSGTLFPSHALRNVSENRVVIESDVAVPASVFVTVNQG 486 >ref|XP_003543877.1| PREDICTED: polygalacturonase QRT3-like [Glycine max] Length = 489 Score = 84.3 bits (207), Expect = 9e-15 Identities = 38/58 (65%), Positives = 47/58 (81%) Frame = +3 Query: 12 DFNPILLFPDFVKHVQYTFSTSGSSFPNHALRNVSKNNVVIESDVPIQATVFVLVDQG 185 DFN +LLFP+ +KHV Y+ S SG++FPNHALRNVS+N VVIE+D + A VFV VDQG Sbjct: 429 DFNKVLLFPNLIKHVVYSLSASGNTFPNHALRNVSQNRVVIETDEAVNANVFVTVDQG 486 >gb|ADN34218.1| polygalacturonase [Cucumis melo subsp. melo] Length = 515 Score = 82.0 bits (201), Expect = 5e-14 Identities = 36/60 (60%), Positives = 47/60 (78%) Frame = +3 Query: 6 ILDFNPILLFPDFVKHVQYTFSTSGSSFPNHALRNVSKNNVVIESDVPIQATVFVLVDQG 185 +LDFNP+LLFP+ +K+VQYTF +S + FP H +RNVS N VVIE+DV + +VF VDQG Sbjct: 454 VLDFNPVLLFPNLIKNVQYTFRSSDNGFPKHIVRNVSDNQVVIETDVAVVGSVFATVDQG 513