BLASTX nr result
ID: Cephaelis21_contig00052956
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052956 (311 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002463853.1| hypothetical protein SORBIDRAFT_01g007450 [S... 54 1e-05 >ref|XP_002463853.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor] gi|241917707|gb|EER90851.1| hypothetical protein SORBIDRAFT_01g007450 [Sorghum bicolor] Length = 839 Score = 54.3 bits (129), Expect = 1e-05 Identities = 26/52 (50%), Positives = 33/52 (63%) Frame = +2 Query: 155 FIFLVFLSINVKLAMADISSSPGTFIPADSYLINCGSPSSTLLDDGRTFKSD 310 FI L L I + I+S G F+P D+YLI+CG+ S LDDGRTF+SD Sbjct: 14 FIILSILGITSVTSTNAIASQKGPFVPQDNYLISCGASGSVQLDDGRTFRSD 65