BLASTX nr result
ID: Cephaelis21_contig00052758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052758 (278 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|ZP_11905355.1| hypothetical protein SAO11_2768 [Staphylococc... 157 1e-36 ref|ZP_17655234.1| hypothetical protein MUY_00182 [Bacillus lich... 97 7e-23 ref|ZP_04287638.1| hypothetical protein bcere0009_4300 [Bacillus... 46 7e-14 ref|ZP_04265349.1| hypothetical protein bcere0014_55000 [Bacillu... 44 1e-13 ref|ZP_17647444.1| hypothetical protein IKS_00048 [Bacillus cere... 44 2e-13 >ref|ZP_11905355.1| hypothetical protein SAO11_2768 [Staphylococcus aureus O11] gi|421150993|ref|ZP_15610642.1| hypothetical protein Newbould305_2746 [Staphylococcus aureus subsp. aureus str. Newbould 305] gi|421150998|ref|ZP_15610645.1| hypothetical protein Newbould305_2749 [Staphylococcus aureus subsp. aureus str. Newbould 305] gi|323438360|gb|EGA96134.1| hypothetical protein SAO11_2768 [Staphylococcus aureus O11] gi|394328931|gb|EJE55074.1| hypothetical protein Newbould305_2749 [Staphylococcus aureus subsp. aureus str. Newbould 305] gi|394328940|gb|EJE55076.1| hypothetical protein Newbould305_2746 [Staphylococcus aureus subsp. aureus str. Newbould 305] Length = 85 Score = 157 bits (396), Expect = 1e-36 Identities = 75/83 (90%), Positives = 78/83 (93%) Frame = +3 Query: 3 RRTQDPLKRVYIFDYRIITFFDSTFQMIRLIYTFVTPYRVSYNPNKQACWFGLFPFRSPL 182 RRTQDPLKR IFDYRIITFFDS+FQMIRL+ +FVTPYRVSYNPNKQACWFGLFPFRSPL Sbjct: 3 RRTQDPLKRDNIFDYRIITFFDSSFQMIRLMSSFVTPYRVSYNPNKQACWFGLFPFRSPL 62 Query: 183 LRESIFLSLPPGTKMFQFSGSAF 251 LRES FLSLPPGTKMFQFSG AF Sbjct: 63 LRESNFLSLPPGTKMFQFSGCAF 85 >ref|ZP_17655234.1| hypothetical protein MUY_00182 [Bacillus licheniformis WX-02] gi|423680416|ref|ZP_17655255.1| hypothetical protein MUY_00209 [Bacillus licheniformis WX-02] gi|383441501|gb|EID49210.1| hypothetical protein MUY_00182 [Bacillus licheniformis WX-02] gi|383441522|gb|EID49231.1| hypothetical protein MUY_00209 [Bacillus licheniformis WX-02] Length = 154 Score = 97.1 bits (240), Expect(2) = 7e-23 Identities = 49/65 (75%), Positives = 54/65 (83%) Frame = +2 Query: 74 FPDDSSNIYFCNSI*SVLQPQQASLLVWALPVSLAATQGIDFSFSSSGY*DVSVLRVCLL 253 F SS +FCNS+ SVLQPQ+ASLLVWA+PVSLAATQGI F+FSSSGY DVSV RVCLL Sbjct: 27 FQTSSSTSFFCNSVQSVLQPQEASLLVWAVPVSLAATQGIAFAFSSSGYLDVSVPRVCLL 86 Query: 254 TCYEF 268 YEF Sbjct: 87 ISYEF 91 Score = 35.0 bits (79), Expect(2) = 7e-23 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 3 RRTQDPLKRVYIFDYRIITFFDSTFQ 80 RRTQDPL+R FDYR +T + FQ Sbjct: 3 RRTQDPLRRERSFDYRAVTSYGGPFQ 28 >ref|ZP_04287638.1| hypothetical protein bcere0009_4300 [Bacillus cereus R309803] gi|228623843|gb|EEK80656.1| hypothetical protein bcere0009_4300 [Bacillus cereus R309803] Length = 143 Score = 45.8 bits (107), Expect(3) = 7e-14 Identities = 18/26 (69%), Positives = 23/26 (88%) Frame = +3 Query: 84 IRLIYTFVTPYRVSYNPNKQACWFGL 161 +RL ++FVTPYR+SYNP +QA WFGL Sbjct: 43 LRLPHSFVTPYRMSYNPKRQASWFGL 68 Score = 38.1 bits (87), Expect(3) = 7e-14 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +1 Query: 1 SVVLRIHSREYIFSTTGLLPSLIQLSR 81 S VLRIHSRE STTGLLPS LSR Sbjct: 15 SAVLRIHSRENEVSTTGLLPSTTDLSR 41 Score = 37.4 bits (85), Expect(3) = 7e-14 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 167 VSLAATQGIDFSFSSSGY*DVSVLRVCL 250 VSLAATQ I F+FSSS Y DVSV VCL Sbjct: 71 VSLAATQEIAFAFSSSRYLDVSVPWVCL 98 >ref|ZP_04265349.1| hypothetical protein bcere0014_55000 [Bacillus cereus BDRD-ST196] gi|423421589|ref|ZP_17398678.1| hypothetical protein IE3_05061 [Bacillus cereus BAG3X2-1] gi|423456839|ref|ZP_17433657.1| hypothetical protein IEE_05548 [Bacillus cereus BAG5X1-1] gi|423515122|ref|ZP_17491603.1| hypothetical protein IG7_00192 [Bacillus cereus HuA2-4] gi|423519576|ref|ZP_17496057.1| hypothetical protein IG7_04646 [Bacillus cereus HuA2-4] gi|423520668|ref|ZP_17497141.1| hypothetical protein IGC_00051 [Bacillus cereus HuA4-10] gi|228646772|gb|EEL02946.1| hypothetical protein bcere0014_55000 [Bacillus cereus BDRD-ST196] gi|401097251|gb|EJQ05279.1| hypothetical protein IE3_05061 [Bacillus cereus BAG3X2-1] gi|401127523|gb|EJQ35244.1| hypothetical protein IEE_05548 [Bacillus cereus BAG5X1-1] gi|401157717|gb|EJQ65113.1| hypothetical protein IG7_04646 [Bacillus cereus HuA2-4] gi|401167785|gb|EJQ75061.1| hypothetical protein IG7_00192 [Bacillus cereus HuA2-4] gi|401179765|gb|EJQ86928.1| hypothetical protein IGC_00051 [Bacillus cereus HuA4-10] Length = 143 Score = 44.3 bits (103), Expect(3) = 1e-13 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 84 IRLIYTFVTPYRVSYNPNKQACWFGL 161 +RL +FVTPYR+SYNP +QA WFGL Sbjct: 43 LRLPRSFVTPYRMSYNPKRQASWFGL 68 Score = 38.9 bits (89), Expect(3) = 1e-13 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +1 Query: 1 SVVLRIHSREYIFSTTGLLPSLIQLSR 81 S VLRIHSRE STTGLLPS+ LSR Sbjct: 15 SAVLRIHSRENEVSTTGLLPSVTDLSR 41 Score = 37.4 bits (85), Expect(3) = 1e-13 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 167 VSLAATQGIDFSFSSSGY*DVSVLRVCL 250 VSLAATQ I F+FSSS Y DVSV VCL Sbjct: 71 VSLAATQEIAFAFSSSRYLDVSVPWVCL 98 >ref|ZP_17647444.1| hypothetical protein IKS_00048 [Bacillus cereus VDM062] gi|401311611|gb|EJS16897.1| hypothetical protein IKS_00048 [Bacillus cereus VDM062] Length = 143 Score = 44.3 bits (103), Expect(3) = 2e-13 Identities = 18/26 (69%), Positives = 22/26 (84%) Frame = +3 Query: 84 IRLIYTFVTPYRVSYNPNKQACWFGL 161 +RL +FVTPYR+SYNP +QA WFGL Sbjct: 43 LRLPRSFVTPYRMSYNPKRQASWFGL 68 Score = 38.1 bits (87), Expect(3) = 2e-13 Identities = 20/27 (74%), Positives = 20/27 (74%) Frame = +1 Query: 1 SVVLRIHSREYIFSTTGLLPSLIQLSR 81 S VLRIHSRE STTGLLPS LSR Sbjct: 15 SAVLRIHSRENEVSTTGLLPSATDLSR 41 Score = 37.4 bits (85), Expect(3) = 2e-13 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = +2 Query: 167 VSLAATQGIDFSFSSSGY*DVSVLRVCL 250 VSLAATQ I F+FSSS Y DVSV VCL Sbjct: 71 VSLAATQEIAFAFSSSRYLDVSVPWVCL 98