BLASTX nr result
ID: Cephaelis21_contig00052666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00052666 (313 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus com... 70 2e-10 ref|NP_194101.1| cation/H(+) antiporter 17 [Arabidopsis thaliana... 64 1e-08 ref|XP_002297994.1| cation proton exchanger [Populus trichocarpa... 64 2e-08 ref|XP_002868583.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata] g... 61 8e-08 gb|ACC91256.1| putative cation/hydrogen exchanger [Capsella rube... 61 1e-07 >ref|XP_002509894.1| Na(+)/H(+) antiporter, putative [Ricinus communis] gi|223549793|gb|EEF51281.1| Na(+)/H(+) antiporter, putative [Ricinus communis] Length = 805 Score = 69.7 bits (169), Expect = 2e-10 Identities = 38/59 (64%), Positives = 48/59 (81%) Frame = +2 Query: 2 CNLFLVGKKPDGELALSLNGRSDQSPELGPVGSLLINSKAFSTTASVLVIQQCQNKGTL 178 CNLFLVG+ P+GE+A++LN R ++ PELGPVGSLL S FSTTASVLVIQQ ++ +L Sbjct: 731 CNLFLVGRMPEGEIAIALN-RWNECPELGPVGSLLATSN-FSTTASVLVIQQYDSQVSL 787 >ref|NP_194101.1| cation/H(+) antiporter 17 [Arabidopsis thaliana] gi|75313911|sp|Q9SUQ7.1|CHX17_ARATH RecName: Full=Cation/H(+) antiporter 17; AltName: Full=Protein CATION/H+ EXCHANGER 17; Short=AtCHX17 gi|4454039|emb|CAA23036.1| putative Na+/H+-exchanging protein [Arabidopsis thaliana] gi|7269218|emb|CAB79325.1| putative Na+/H+-exchanging protein [Arabidopsis thaliana] gi|61658323|gb|AAX49545.1| cation/H+ exchanger [Arabidopsis thaliana] gi|332659396|gb|AEE84796.1| cation/H(+) antiporter 17 [Arabidopsis thaliana] Length = 820 Score = 64.3 bits (155), Expect = 1e-08 Identities = 32/51 (62%), Positives = 41/51 (80%) Frame = +2 Query: 5 NLFLVGKKPDGELALSLNGRSDQSPELGPVGSLLINSKAFSTTASVLVIQQ 157 NLFLVGK P+G +A +N RSD +PELGP+G+LL S++ ST ASVLV+QQ Sbjct: 745 NLFLVGKSPEGSVASGINVRSD-TPELGPIGNLLTESESVSTVASVLVVQQ 794 >ref|XP_002297994.1| cation proton exchanger [Populus trichocarpa] gi|222845252|gb|EEE82799.1| cation proton exchanger [Populus trichocarpa] Length = 804 Score = 63.5 bits (153), Expect = 2e-08 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = +2 Query: 5 NLFLVGKKPDGELALSLNGRSDQSPELGPVGSLLINSKAFSTTASVLVIQQCQNKGTL 178 NLFLVG+ PDGE+AL L SD SPELGPVG LL +S STTASVLV++Q ++ +L Sbjct: 742 NLFLVGRLPDGEIALDLRSSSD-SPELGPVGGLLASSD-ISTTASVLVVKQYSSRVSL 797 >ref|XP_002868583.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata] gi|297314419|gb|EFH44842.1| ATCHX18 [Arabidopsis lyrata subsp. lyrata] Length = 810 Score = 61.2 bits (147), Expect = 8e-08 Identities = 35/57 (61%), Positives = 43/57 (75%) Frame = +2 Query: 5 NLFLVGKKPDGELALSLNGRSDQSPELGPVGSLLINSKAFSTTASVLVIQQCQNKGT 175 NLFLVG+ P GE+AL++ S + PELGPVGSLLI+ ++ ST ASVLVIQQ GT Sbjct: 736 NLFLVGRMPGGEIALAIRENS-ECPELGPVGSLLISPES-STKASVLVIQQYNGTGT 790 >gb|ACC91256.1| putative cation/hydrogen exchanger [Capsella rubella] Length = 819 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/51 (56%), Positives = 38/51 (74%) Frame = +2 Query: 5 NLFLVGKKPDGELALSLNGRSDQSPELGPVGSLLINSKAFSTTASVLVIQQ 157 NLFLVGK P+G +A L+ +PELGP+G+LL S++ ST ASVLV+QQ Sbjct: 743 NLFLVGKSPEGSVASGLHVERSDTPELGPIGNLLTASESVSTVASVLVVQQ 793