BLASTX nr result
ID: Cephaelis21_contig00051970
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051970 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633638.1| PREDICTED: putative sodium/calcium exchanger... 82 3e-14 emb|CBI36752.3| unnamed protein product [Vitis vinifera] 82 3e-14 ref|XP_002284854.1| PREDICTED: putative sodium/calcium exchanger... 82 3e-14 emb|CAN61084.1| hypothetical protein VITISV_041917 [Vitis vinifera] 82 3e-14 ref|XP_002512354.1| cation:cation antiporter, putative [Ricinus ... 80 2e-13 >ref|XP_003633638.1| PREDICTED: putative sodium/calcium exchanger 7-like isoform 2 [Vitis vinifera] Length = 552 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 3 LISSLMGSMLVVTWNRFRVPRFWGFCLVGIYVVFMAVSLIIAKY 134 L+SSLMGS+LV+TW RFRVPRFWGFCLVG+YVVFM VS++IAK+ Sbjct: 507 LLSSLMGSLLVITWGRFRVPRFWGFCLVGLYVVFMVVSILIAKF 550 >emb|CBI36752.3| unnamed protein product [Vitis vinifera] Length = 491 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 3 LISSLMGSMLVVTWNRFRVPRFWGFCLVGIYVVFMAVSLIIAKY 134 L+SSLMGS+LV+TW RFRVPRFWGFCLVG+YVVFM VS++IAK+ Sbjct: 375 LLSSLMGSLLVITWGRFRVPRFWGFCLVGLYVVFMVVSILIAKF 418 >ref|XP_002284854.1| PREDICTED: putative sodium/calcium exchanger 7-like isoform 1 [Vitis vinifera] Length = 532 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 3 LISSLMGSMLVVTWNRFRVPRFWGFCLVGIYVVFMAVSLIIAKY 134 L+SSLMGS+LV+TW RFRVPRFWGFCLVG+YVVFM VS++IAK+ Sbjct: 487 LLSSLMGSLLVITWGRFRVPRFWGFCLVGLYVVFMVVSILIAKF 530 >emb|CAN61084.1| hypothetical protein VITISV_041917 [Vitis vinifera] Length = 557 Score = 82.4 bits (202), Expect = 3e-14 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = +3 Query: 3 LISSLMGSMLVVTWNRFRVPRFWGFCLVGIYVVFMAVSLIIAKY 134 L+SSLMGS+LV+TW RFRVPRFWGFCLVG+YVVFM VS++IAK+ Sbjct: 512 LLSSLMGSLLVITWGRFRVPRFWGFCLVGLYVVFMVVSILIAKF 555 >ref|XP_002512354.1| cation:cation antiporter, putative [Ricinus communis] gi|223548315|gb|EEF49806.1| cation:cation antiporter, putative [Ricinus communis] Length = 408 Score = 79.7 bits (195), Expect = 2e-13 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = +3 Query: 3 LISSLMGSMLVVTWNRFRVPRFWGFCLVGIYVVFMAVSLIIAKY 134 L SLMGS+LV+TW+RFRVPRFWGFCLVG+YV+FM VSL+IAK+ Sbjct: 363 LFLSLMGSLLVITWSRFRVPRFWGFCLVGLYVLFMVVSLVIAKF 406