BLASTX nr result
ID: Cephaelis21_contig00051840
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051840 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003520702.1| PREDICTED: NAC domain-containing protein 90-... 57 1e-06 ref|XP_003553602.1| PREDICTED: NAC domain-containing protein 90-... 56 3e-06 >ref|XP_003520702.1| PREDICTED: NAC domain-containing protein 90-like [Glycine max] Length = 257 Score = 57.4 bits (137), Expect = 1e-06 Identities = 35/75 (46%), Positives = 46/75 (61%), Gaps = 8/75 (10%) Frame = +3 Query: 6 YRAIDGQVSSS----SPPKLRQELSLCRVYKGSKSVRTFDRRPPP----AGAAGSVHHEI 161 Y AI G+ SSS + P LR+E SLCRVYK SK +R FDRRPPP +G+ + E Sbjct: 133 YSAIKGEPSSSISNKAVPTLRKEFSLCRVYKKSKCLRAFDRRPPPRRDVVSYSGAQNVE- 191 Query: 162 GETSGTGQPDHHHEI 206 + G+ D+HH+I Sbjct: 192 EQQKGSTLYDYHHKI 206 >ref|XP_003553602.1| PREDICTED: NAC domain-containing protein 90-like [Glycine max] Length = 254 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/63 (44%), Positives = 39/63 (61%), Gaps = 4/63 (6%) Frame = +3 Query: 30 SSSSPPKLRQELSLCRVYKGSKSVRTFDRRPPP----AGAAGSVHHEIGETSGTGQPDHH 197 +SSS P LR+E +LCRVYK SK + FDRRPPP +G+ + E + T D+H Sbjct: 138 TSSSSPTLRKEFNLCRVYKKSKCLTAFDRRPPPRRDTESYSGAQNVEEQQKGSTSYDDYH 197 Query: 198 HEI 206 H++ Sbjct: 198 HKM 200