BLASTX nr result
ID: Cephaelis21_contig00051800
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051800 (226 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003596162.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 54 4e-09 ref|XP_003596169.1| 1-aminocyclopropane-1-carboxylate oxidase-li... 51 7e-09 ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative ... 55 9e-09 ref|XP_004134415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 50 9e-09 ref|XP_004167607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 50 1e-08 >ref|XP_003596162.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485210|gb|AES66413.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 381 Score = 53.9 bits (128), Expect(2) = 4e-09 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -2 Query: 225 QILHDNQWIDVPPIPGSLVVNIADLLQV 142 QILHDNQWIDVPPI G+LVVNI DLLQ+ Sbjct: 263 QILHDNQWIDVPPIHGALVVNIGDLLQL 290 Score = 31.6 bits (70), Expect(2) = 4e-09 Identities = 13/17 (76%), Positives = 16/17 (94%) Frame = -1 Query: 52 QIVSNDKFKSVEHRVIA 2 Q+VSNDKF SV+HRV+A Sbjct: 289 QLVSNDKFTSVQHRVLA 305 >ref|XP_003596169.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] gi|355485217|gb|AES66420.1| 1-aminocyclopropane-1-carboxylate oxidase-like protein [Medicago truncatula] Length = 200 Score = 51.2 bits (121), Expect(2) = 7e-09 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = -2 Query: 225 QILHDNQWIDVPPIPGSLVVNIADLLQVCIS*VFR 121 Q+LH ++WIDVPP+PG+LVVNI DLLQ+ + F+ Sbjct: 91 QVLHQDKWIDVPPVPGALVVNIGDLLQLITNDKFK 125 Score = 33.5 bits (75), Expect(2) = 7e-09 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -1 Query: 52 QIVSNDKFKSVEHRVIA 2 Q+++NDKFKSVEHRV+A Sbjct: 117 QLITNDKFKSVEHRVLA 133 >ref|XP_002529299.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] gi|223531223|gb|EEF33068.1| Desacetoxyvindoline 4-hydroxylase, putative [Ricinus communis] Length = 652 Score = 55.5 bits (132), Expect(2) = 9e-09 Identities = 23/28 (82%), Positives = 26/28 (92%) Frame = -2 Query: 225 QILHDNQWIDVPPIPGSLVVNIADLLQV 142 Q+LHDNQW+DV PIPGSLVVNI DLLQ+ Sbjct: 566 QVLHDNQWVDVQPIPGSLVVNIGDLLQI 593 Score = 28.9 bits (63), Expect(2) = 9e-09 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -1 Query: 52 QIVSNDKFKSVEHRVI 5 QIVSNDKFKS HRV+ Sbjct: 592 QIVSNDKFKSNVHRVL 607 >ref|XP_004134415.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Cucumis sativus] Length = 386 Score = 50.4 bits (119), Expect(2) = 9e-09 Identities = 18/28 (64%), Positives = 26/28 (92%) Frame = -2 Query: 225 QILHDNQWIDVPPIPGSLVVNIADLLQV 142 Q+LH+ +W+D+PPIPG+LV+NI DLLQ+ Sbjct: 269 QVLHEKKWVDIPPIPGALVINIGDLLQL 296 Score = 33.9 bits (76), Expect(2) = 9e-09 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -1 Query: 52 QIVSNDKFKSVEHRVIA 2 Q++SND+FKSVEHRV+A Sbjct: 295 QLISNDRFKSVEHRVVA 311 >ref|XP_004167607.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase homolog 1-like [Cucumis sativus] Length = 375 Score = 50.4 bits (119), Expect(2) = 1e-08 Identities = 18/28 (64%), Positives = 26/28 (92%) Frame = -2 Query: 225 QILHDNQWIDVPPIPGSLVVNIADLLQV 142 Q+LH+ +W+D+PPIPG+LV+NI DLLQ+ Sbjct: 258 QVLHEKKWVDIPPIPGALVINIGDLLQL 285 Score = 33.9 bits (76), Expect(2) = 1e-08 Identities = 13/17 (76%), Positives = 17/17 (100%) Frame = -1 Query: 52 QIVSNDKFKSVEHRVIA 2 Q++SND+FKSVEHRV+A Sbjct: 284 QLISNDRFKSVEHRVVA 300