BLASTX nr result
ID: Cephaelis21_contig00051677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051677 (483 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281928.1| PREDICTED: uncharacterized protein LOC100262... 100 9e-20 emb|CAN63286.1| hypothetical protein VITISV_025194 [Vitis vinifera] 100 9e-20 ref|XP_002311560.1| predicted protein [Populus trichocarpa] gi|2... 100 1e-19 ref|XP_002315831.1| predicted protein [Populus trichocarpa] gi|2... 99 5e-19 ref|XP_002521884.1| conserved hypothetical protein [Ricinus comm... 98 8e-19 >ref|XP_002281928.1| PREDICTED: uncharacterized protein LOC100262842 [Vitis vinifera] gi|296081414|emb|CBI16847.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 100 bits (250), Expect = 9e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -2 Query: 146 MGSCGRNGGVRQYIRSKVPRLRWTPDLHRCFVHAIERLGGQDKATPKL 3 MGSCGRNG VRQYIRSKVPRLRWTP+LH CFVHAIERLGGQDKATPKL Sbjct: 1 MGSCGRNGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKL 48 >emb|CAN63286.1| hypothetical protein VITISV_025194 [Vitis vinifera] Length = 303 Score = 100 bits (250), Expect = 9e-20 Identities = 45/48 (93%), Positives = 46/48 (95%) Frame = -2 Query: 146 MGSCGRNGGVRQYIRSKVPRLRWTPDLHRCFVHAIERLGGQDKATPKL 3 MGSCGRNG VRQYIRSKVPRLRWTP+LH CFVHAIERLGGQDKATPKL Sbjct: 1 MGSCGRNGAVRQYIRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKL 48 >ref|XP_002311560.1| predicted protein [Populus trichocarpa] gi|222851380|gb|EEE88927.1| predicted protein [Populus trichocarpa] Length = 78 Score = 100 bits (249), Expect = 1e-19 Identities = 44/48 (91%), Positives = 47/48 (97%) Frame = -2 Query: 146 MGSCGRNGGVRQYIRSKVPRLRWTPDLHRCFVHAIERLGGQDKATPKL 3 MGSCGR+G VRQY+RSKVPRLRWTP+LHRCFVHAIERLGGQDKATPKL Sbjct: 1 MGSCGRSGAVRQYVRSKVPRLRWTPELHRCFVHAIERLGGQDKATPKL 48 >ref|XP_002315831.1| predicted protein [Populus trichocarpa] gi|222864871|gb|EEF02002.1| predicted protein [Populus trichocarpa] Length = 207 Score = 98.6 bits (244), Expect = 5e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 146 MGSCGRNGGVRQYIRSKVPRLRWTPDLHRCFVHAIERLGGQDKATPKL 3 MGSCGR+G VRQY+RSKVPRLRWTP+LH CFVHAIERLGGQDKATPKL Sbjct: 1 MGSCGRSGAVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKL 48 >ref|XP_002521884.1| conserved hypothetical protein [Ricinus communis] gi|223538922|gb|EEF40520.1| conserved hypothetical protein [Ricinus communis] Length = 298 Score = 97.8 bits (242), Expect = 8e-19 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = -2 Query: 146 MGSCGRNGGVRQYIRSKVPRLRWTPDLHRCFVHAIERLGGQDKATPKL 3 MGSCGR+G VRQY+RSKVPRLRWTP+LH CFVHAIERLGGQDKATPKL Sbjct: 1 MGSCGRSGTVRQYVRSKVPRLRWTPELHHCFVHAIERLGGQDKATPKL 48