BLASTX nr result
ID: Cephaelis21_contig00051629
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051629 (439 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516871.1| conserved hypothetical protein [Ricinus comm... 55 4e-06 >ref|XP_002516871.1| conserved hypothetical protein [Ricinus communis] gi|223543959|gb|EEF45485.1| conserved hypothetical protein [Ricinus communis] Length = 343 Score = 55.5 bits (132), Expect = 4e-06 Identities = 32/67 (47%), Positives = 41/67 (61%), Gaps = 1/67 (1%) Frame = -1 Query: 202 ENDAGFTFRIVTPTIFLL*ALPNRLNWSKNGRKYFTARRQILCL-QAISHPDLASFIFDC 26 END GFT+ IV PT F +L ++ K+G+ Y LC + IS PDLASFI DC Sbjct: 157 ENDNGFTYSIVRPTAFFK-SLGGQIELVKDGKPYVMFGDGKLCACKPISEPDLASFIADC 215 Query: 25 FVSEDKV 5 +SEDK+ Sbjct: 216 VLSEDKI 222