BLASTX nr result
ID: Cephaelis21_contig00051559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051559 (237 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002266691.1| PREDICTED: cytochrome P450 724B1 [Vitis vini... 68 9e-10 emb|CAN62336.1| hypothetical protein VITISV_004298 [Vitis vinifera] 68 9e-10 ref|XP_002524586.1| cytochrome P450, putative [Ricinus communis]... 59 3e-07 >ref|XP_002266691.1| PREDICTED: cytochrome P450 724B1 [Vitis vinifera] gi|296085072|emb|CBI28487.3| unnamed protein product [Vitis vinifera] Length = 472 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 97 MAGCFWIIILFCLVGFLSGIILNHFLPLFLKHGLVAKGSFGWPLLGE 237 MA FW ++L LVG + G+ILNHFLPLF K G V KG+FGWPLLGE Sbjct: 1 MAVGFWFVLLVGLVGLVLGLILNHFLPLFFKLGHVPKGTFGWPLLGE 47 >emb|CAN62336.1| hypothetical protein VITISV_004298 [Vitis vinifera] Length = 472 Score = 67.8 bits (164), Expect = 9e-10 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = +1 Query: 97 MAGCFWIIILFCLVGFLSGIILNHFLPLFLKHGLVAKGSFGWPLLGE 237 MA FW ++L LVG + G+ILNHFLPLF K G V KG+FGWPLLGE Sbjct: 1 MAVGFWFVLLVGLVGLVLGLILNHFLPLFFKLGHVPKGTFGWPLLGE 47 >ref|XP_002524586.1| cytochrome P450, putative [Ricinus communis] gi|223536139|gb|EEF37794.1| cytochrome P450, putative [Ricinus communis] Length = 523 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/51 (54%), Positives = 35/51 (68%), Gaps = 2/51 (3%) Frame = +1 Query: 91 LSMAGCFWIIILFCLVGFLSGIILNHFLPLFLKHGL--VAKGSFGWPLLGE 237 ++ GC W+ +L + L GII NHFLP+FLK G V KGSFGWP+LGE Sbjct: 1 MAATGCSWLGVLVGIFCGLLGIIFNHFLPMFLKRGSDHVPKGSFGWPILGE 51