BLASTX nr result
ID: Cephaelis21_contig00051087
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051087 (503 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCH50976.1| T4.15 [Malus x robusta] 55 8e-06 >emb|CCH50976.1| T4.15 [Malus x robusta] Length = 986 Score = 54.7 bits (130), Expect = 8e-06 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 4/92 (4%) Frame = -2 Query: 319 VAELRSLRWM*SFAR---ISNKFIKKKLGVAPRNKKTKENLLW*FRHVHRRLSLAPV-*C 152 VAE+R LRWM R I N+ I+ K+GVA K +EN L F HV RR + AP+ C Sbjct: 873 VAEMRMLRWMCGHTRKDKIRNEDIRGKVGVAEIQGKMRENQLRWFGHVQRRPTDAPIRRC 932 Query: 151 VENKELLSQIIRRKI*KDLENAIRKDMNYLSM 56 E+ + R + K LE +RKD+ YL + Sbjct: 933 DYGTEVQGRRGRGRPRKTLEETLRKDLEYLDL 964