BLASTX nr result
ID: Cephaelis21_contig00051029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00051029 (242 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] 57 1e-06 >emb|CAN60544.1| hypothetical protein VITISV_006250 [Vitis vinifera] Length = 833 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/59 (42%), Positives = 38/59 (64%) Frame = -1 Query: 185 RILVWNCQGIGSSSTLRIVKDFISQYNVTILVLLETRISGVQADRVIKHIGLRHSFRVE 9 ++L WNC+G G +R +KD I + +I+VLLE +ISG AD+VIK IG + ++ Sbjct: 668 KLLCWNCRGAGELKFMRAIKDLIKLHEPSIVVLLEPKISGGDADQVIKEIGFSGQYHID 726