BLASTX nr result
ID: Cephaelis21_contig00050781
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050781 (230 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002267062.2| PREDICTED: uncharacterized protein LOC100262... 89 5e-16 emb|CBI22563.3| unnamed protein product [Vitis vinifera] 89 5e-16 ref|XP_002526190.1| ATP binding protein, putative [Ricinus commu... 89 5e-16 ref|XP_003616137.1| Ubiquitin [Medicago truncatula] gi|355517472... 88 8e-16 ref|NP_198531.2| DEXDc and putative helicase domain-containing p... 84 2e-14 >ref|XP_002267062.2| PREDICTED: uncharacterized protein LOC100262126 [Vitis vinifera] Length = 1095 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/75 (53%), Positives = 56/75 (74%) Frame = +2 Query: 5 NVKDASYNKHFLEGCIYGSYSFIHINNGTERFDKYSPKNLVEVYVVDEIISNLYKHFLVT 184 NVKD SY K FL+G +YG YSF+++ G E F+ +S +N+VEV VV E++++L+K + Sbjct: 726 NVKDRSYEKQFLQGSMYGPYSFVNVAYGKEEFENHSSRNMVEVAVVSEVVTSLFKESVSK 785 Query: 185 EQKVRVGCISPYKAQ 229 +QKV VG ISPYKAQ Sbjct: 786 KQKVSVGVISPYKAQ 800 >emb|CBI22563.3| unnamed protein product [Vitis vinifera] Length = 956 Score = 88.6 bits (218), Expect = 5e-16 Identities = 40/75 (53%), Positives = 56/75 (74%) Frame = +2 Query: 5 NVKDASYNKHFLEGCIYGSYSFIHINNGTERFDKYSPKNLVEVYVVDEIISNLYKHFLVT 184 NVKD SY K FL+G +YG YSF+++ G E F+ +S +N+VEV VV E++++L+K + Sbjct: 588 NVKDRSYEKQFLQGSMYGPYSFVNVAYGKEEFENHSSRNMVEVAVVSEVVTSLFKESVSK 647 Query: 185 EQKVRVGCISPYKAQ 229 +QKV VG ISPYKAQ Sbjct: 648 KQKVSVGVISPYKAQ 662 >ref|XP_002526190.1| ATP binding protein, putative [Ricinus communis] gi|223534494|gb|EEF36194.1| ATP binding protein, putative [Ricinus communis] Length = 782 Score = 88.6 bits (218), Expect = 5e-16 Identities = 42/77 (54%), Positives = 61/77 (79%), Gaps = 1/77 (1%) Frame = +2 Query: 2 LNVKDASYNKHFLEGCIYGSYSFIHINNGTERFDKY-SPKNLVEVYVVDEIISNLYKHFL 178 LNVK+ S+ + FLEG +Y SYSFI+I++G E FD++ S +N+VEV VV +I++NL+ F+ Sbjct: 388 LNVKEISHERRFLEGNMYSSYSFINISHGKEEFDEFRSLRNMVEVAVVSDIVANLFSEFI 447 Query: 179 VTEQKVRVGCISPYKAQ 229 T++KV +G ISPYKAQ Sbjct: 448 STKKKVSIGIISPYKAQ 464 >ref|XP_003616137.1| Ubiquitin [Medicago truncatula] gi|355517472|gb|AES99095.1| Ubiquitin [Medicago truncatula] Length = 1337 Score = 87.8 bits (216), Expect = 8e-16 Identities = 46/77 (59%), Positives = 57/77 (74%), Gaps = 1/77 (1%) Frame = +2 Query: 2 LNVKDASYNKHFLEGCIYGSYSFIHINNGTERFDK-YSPKNLVEVYVVDEIISNLYKHFL 178 L VKD SYNK FLEG +Y SYSFI+I+ G E+F +S KN+VEV V+ EII NL K F+ Sbjct: 1132 LAVKDQSYNKSFLEGEMYSSYSFINISKGKEKFGHGHSLKNMVEVAVISEIIKNLRKEFM 1191 Query: 179 VTEQKVRVGCISPYKAQ 229 T++KV +G ISPY AQ Sbjct: 1192 RTKKKVSIGIISPYNAQ 1208 >ref|NP_198531.2| DEXDc and putative helicase domain-containing protein [Arabidopsis thaliana] gi|332006764|gb|AED94147.1| DEXDc and putative helicase domain-containing protein [Arabidopsis thaliana] Length = 839 Score = 83.6 bits (205), Expect = 2e-14 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 1/76 (1%) Frame = +2 Query: 5 NVKDASYNKHFLEGCIYGSYSFIHINNGTERF-DKYSPKNLVEVYVVDEIISNLYKHFLV 181 NVK++ Y K FL+G ++GS+SFI++ G E F D +SPKN+VEV VV EIISNL+K Sbjct: 624 NVKESIYQKRFLQGNMFGSFSFINVGRGKEEFGDGHSPKNMVEVAVVSEIISNLFKVSCE 683 Query: 182 TEQKVRVGCISPYKAQ 229 KV VG +SPYK Q Sbjct: 684 RRMKVSVGVVSPYKGQ 699