BLASTX nr result
ID: Cephaelis21_contig00050753
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050753 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285601.1| PREDICTED: uncharacterized protein LOC100255... 75 4e-12 ref|XP_002527342.1| hypothetical protein RCOM_0482310 [Ricinus c... 72 6e-11 gb|ACJ54183.1| PB1 domain-containing protein [Nicotiana benthami... 71 1e-10 ref|XP_002298807.1| predicted protein [Populus trichocarpa] gi|2... 70 1e-10 ref|NP_196524.1| octicosapeptide/Phox/Bem1p domain-containing pr... 70 2e-10 >ref|XP_002285601.1| PREDICTED: uncharacterized protein LOC100255721 [Vitis vinifera] Length = 462 Score = 75.5 bits (184), Expect = 4e-12 Identities = 35/59 (59%), Positives = 45/59 (76%) Frame = -3 Query: 213 KPPSTQAPNHKVKLICSYGGKIQPAPMGNKLMYSGGDNKILTVDRNIKFDDFVSKVNSV 37 +PPS N+KVK +CSYGGKI P P N+L Y GG+ KIL+VDRNIKF F+SK++S+ Sbjct: 29 EPPS----NYKVKFMCSYGGKIHPRPQDNQLAYVGGETKILSVDRNIKFPGFMSKISSI 83 >ref|XP_002527342.1| hypothetical protein RCOM_0482310 [Ricinus communis] gi|223533261|gb|EEF35014.1| hypothetical protein RCOM_0482310 [Ricinus communis] Length = 415 Score = 71.6 bits (174), Expect = 6e-11 Identities = 34/56 (60%), Positives = 41/56 (73%) Frame = -3 Query: 204 STQAPNHKVKLICSYGGKIQPAPMGNKLMYSGGDNKILTVDRNIKFDDFVSKVNSV 37 S+ N+KVK +CSYGGKIQP P N+L Y GGD KIL V+RNIKF F+SK S+ Sbjct: 37 SSNNNNYKVKFMCSYGGKIQPRPHDNQLAYIGGDTKILAVERNIKFSLFISKFASL 92 >gb|ACJ54183.1| PB1 domain-containing protein [Nicotiana benthamiana] Length = 254 Score = 70.9 bits (172), Expect = 1e-10 Identities = 32/60 (53%), Positives = 46/60 (76%) Frame = -3 Query: 213 KPPSTQAPNHKVKLICSYGGKIQPAPMGNKLMYSGGDNKILTVDRNIKFDDFVSKVNSVS 34 +PPS+ +KVK +CSYGGKI P P N+L Y GG+ KIL+VDRNI+F + ++K++S+S Sbjct: 32 QPPSS----YKVKFMCSYGGKIHPRPHDNQLAYVGGETKILSVDRNIRFSNLITKLSSIS 87 >ref|XP_002298807.1| predicted protein [Populus trichocarpa] gi|222846065|gb|EEE83612.1| predicted protein [Populus trichocarpa] Length = 479 Score = 70.5 bits (171), Expect = 1e-10 Identities = 31/56 (55%), Positives = 42/56 (75%) Frame = -3 Query: 204 STQAPNHKVKLICSYGGKIQPAPMGNKLMYSGGDNKILTVDRNIKFDDFVSKVNSV 37 S Q+ N+KVK +CSYGGKI P P N+L Y GG+ KIL VDRN+KF +SK++++ Sbjct: 35 SQQSQNYKVKFMCSYGGKIHPRPHDNQLSYMGGETKILAVDRNLKFPVMISKLSAL 90 >ref|NP_196524.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis thaliana] gi|7671427|emb|CAB89368.1| putative protein [Arabidopsis thaliana] gi|9758990|dbj|BAB09517.1| unnamed protein product [Arabidopsis thaliana] gi|332004035|gb|AED91418.1| octicosapeptide/Phox/Bem1p domain-containing protein [Arabidopsis thaliana] Length = 531 Score = 69.7 bits (169), Expect = 2e-10 Identities = 32/54 (59%), Positives = 41/54 (75%) Frame = -3 Query: 198 QAPNHKVKLICSYGGKIQPAPMGNKLMYSGGDNKILTVDRNIKFDDFVSKVNSV 37 Q N+KVKL+CSYGGKIQP P N+L Y GD KI++VDR I+F VSK+++V Sbjct: 34 QQQNYKVKLMCSYGGKIQPRPHDNQLTYVNGDTKIMSVDRGIRFPALVSKLSAV 87