BLASTX nr result
ID: Cephaelis21_contig00050687
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050687 (260 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002516676.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002516676.1| conserved hypothetical protein [Ricinus communis] gi|223544171|gb|EEF45695.1| conserved hypothetical protein [Ricinus communis] Length = 153 Score = 60.1 bits (144), Expect = 2e-07 Identities = 23/65 (35%), Positives = 46/65 (70%) Frame = +1 Query: 64 LSSRIHEQFWEL*ENTVVVKLMGKSIGYTLICSKLRALWSPANGFRVIDLENNLFLVKLN 243 LS ++ + + ++VVKL+G+ IGY ++CS+++ALW + +V+DL+NN FL++ + Sbjct: 81 LSRQLSQYITHPCKQSIVVKLLGRPIGYNMLCSRIKALWKSISFLKVVDLDNNYFLIRFS 140 Query: 244 EKEEV 258 +E++ Sbjct: 141 HEEDM 145