BLASTX nr result
ID: Cephaelis21_contig00050515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050515 (271 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003539546.1| PREDICTED: tropinone reductase homolog At1g0... 52 4e-06 ref|XP_003539545.1| PREDICTED: tropinone reductase homolog At1g0... 52 4e-06 >ref|XP_003539546.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 2 [Glycine max] Length = 273 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 98 AKIGGNSSRWSVSGMTALVTGGSRGIGPAIGEE 196 A IG SSRWS+ GMTALVTGGS+GIG AI EE Sbjct: 4 ASIGSKSSRWSLQGMTALVTGGSKGIGYAIVEE 36 Score = 23.9 bits (50), Expect(2) = 4e-06 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 222 VRTFSRNEAELNEVL 266 V T +RNEAELNE L Sbjct: 44 VHTCARNEAELNESL 58 >ref|XP_003539545.1| PREDICTED: tropinone reductase homolog At1g07440-like isoform 1 [Glycine max] Length = 267 Score = 51.6 bits (122), Expect(2) = 4e-06 Identities = 25/33 (75%), Positives = 27/33 (81%) Frame = +2 Query: 98 AKIGGNSSRWSVSGMTALVTGGSRGIGPAIGEE 196 A IG SSRWS+ GMTALVTGGS+GIG AI EE Sbjct: 4 ASIGSKSSRWSLQGMTALVTGGSKGIGYAIVEE 36 Score = 23.9 bits (50), Expect(2) = 4e-06 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = +3 Query: 222 VRTFSRNEAELNEVL 266 V T +RNEAELNE L Sbjct: 44 VHTCARNEAELNESL 58