BLASTX nr result
ID: Cephaelis21_contig00050431
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050431 (399 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABK94520.1| unknown [Populus trichocarpa] 55 6e-06 >gb|ABK94520.1| unknown [Populus trichocarpa] Length = 89 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/55 (45%), Positives = 39/55 (70%) Frame = -1 Query: 390 RVQAAKSVDLKIGPAEGSSRSTAGHIPSHIAVNQRKTHKAPSGPNPTGNHRPPTK 226 +VQA ++V K PA+ +S+S G++ + V +++ HK+PSGPNP GNH PP+K Sbjct: 35 KVQAVEAVHFKPNPAQLTSKSHKGNVLP-VWVAEKRIHKSPSGPNPVGNHNPPSK 88