BLASTX nr result
ID: Cephaelis21_contig00050219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050219 (303 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_861410.1| putative multifunctional pol protein [Cestrum y... 94 1e-17 gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] 87 1e-15 gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] 87 1e-15 gb|AEE01492.1| reverse transcriptase [Blueberry red ringspot virus] 87 1e-15 gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] 87 1e-15 >ref|NP_861410.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] gi|75559686|sp|Q7TD08.1|POL_CYLCV RecName: Full=Enzymatic polyprotein; Includes: RecName: Full=Aspartic protease; Includes: RecName: Full=Endonuclease; Includes: RecName: Full=Reverse transcriptase gi|32305282|gb|AAP78924.1| putative multifunctional pol protein [Cestrum yellow leaf curling virus] Length = 643 Score = 94.0 bits (232), Expect = 1e-17 Identities = 42/74 (56%), Positives = 53/74 (71%) Frame = -2 Query: 227 ICKYISGIFKPSEKNYHITEKETLAAL*VFEKWRIDFLPKMFTLRTGSAYLTNFCIYQFK 48 +CKY SGIF +E+ Y + EKETLAAL KW+ + LPK FTLRT S+Y+T F + K Sbjct: 541 LCKYTSGIFSSAEQKYTVHEKETLAALKTMRKWKAELLPKEFTLRTDSSYVTGFARHNLK 600 Query: 47 GNYKQGRLLRWQLQ 6 NY QGRL+RWQL+ Sbjct: 601 ANYNQGRLVRWQLE 614 >gb|AEQ49589.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -2 Query: 227 ICKYISGIFKPSEKNYHITEKETLAAL*VFEKWRIDFLPKMFTLRTGSAYLTNFCIYQFK 48 + KY SG F +EK Y I E ETLA L F KW++D L K F L+T S Y+T F Y+ K Sbjct: 555 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIK 614 Query: 47 GNYKQGRLLRWQLQL 3 NY QGRL+RWQL+L Sbjct: 615 ANYNQGRLIRWQLEL 629 >gb|AEQ38577.1| reverse transcriptase [Blueberry red ringspot virus] Length = 657 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -2 Query: 227 ICKYISGIFKPSEKNYHITEKETLAAL*VFEKWRIDFLPKMFTLRTGSAYLTNFCIYQFK 48 + KY SG F +EK Y I E ETLA L F KW++D L K F L+T S Y+T F Y+ K Sbjct: 555 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIK 614 Query: 47 GNYKQGRLLRWQLQL 3 NY QGRL+RWQL+L Sbjct: 615 ANYNQGRLIRWQLEL 629 >gb|AEE01492.1| reverse transcriptase [Blueberry red ringspot virus] Length = 680 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -2 Query: 227 ICKYISGIFKPSEKNYHITEKETLAAL*VFEKWRIDFLPKMFTLRTGSAYLTNFCIYQFK 48 + KY SG F +EK Y I E ETLA L F KW++D L K F L+T S Y+T F Y+ K Sbjct: 578 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLTKPFILKTDSKYVTGFLRYKIK 637 Query: 47 GNYKQGRLLRWQLQL 3 NY QGRL+RWQL+L Sbjct: 638 ANYNQGRLIRWQLEL 652 >gb|AEH95573.1| reverse transcriptase [Blueberry red ringspot virus] Length = 667 Score = 87.4 bits (215), Expect = 1e-15 Identities = 41/75 (54%), Positives = 50/75 (66%) Frame = -2 Query: 227 ICKYISGIFKPSEKNYHITEKETLAAL*VFEKWRIDFLPKMFTLRTGSAYLTNFCIYQFK 48 + KY SG F +EK Y I E ETLA L F KW++D L K F L+T S Y+T F Y+ K Sbjct: 565 LTKYASGTFTDTEKRYPIHELETLAVLQTFRKWKVDLLSKPFILKTDSKYVTGFLRYKIK 624 Query: 47 GNYKQGRLLRWQLQL 3 NY QGRL+RWQL+L Sbjct: 625 ANYNQGRLIRWQLEL 639