BLASTX nr result
ID: Cephaelis21_contig00050146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050146 (607 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303328.1| predicted protein [Populus trichocarpa] gi|2... 61 1e-07 ref|XP_002532955.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|NP_001236423.1| uncharacterized protein LOC100305512 [Glycin... 59 7e-07 ref|XP_003572634.1| PREDICTED: late embryogenesis abundant prote... 57 2e-06 gb|AAB01566.1| ABA-responsive and embryogenesis-associated gene;... 57 3e-06 >ref|XP_002303328.1| predicted protein [Populus trichocarpa] gi|222840760|gb|EEE78307.1| predicted protein [Populus trichocarpa] Length = 57 Score = 61.2 bits (147), Expect = 1e-07 Identities = 23/35 (65%), Positives = 28/35 (80%) Frame = +1 Query: 355 FWMKDPKTGNWLPETHFNQVDAVELREKLLSKPSQ 459 FWM+DPKTGNW+PE+HF +D E+REK LSK Q Sbjct: 21 FWMRDPKTGNWIPESHFGDIDVAEMREKFLSKKDQ 55 >ref|XP_002532955.1| conserved hypothetical protein [Ricinus communis] gi|223527284|gb|EEF29439.1| conserved hypothetical protein [Ricinus communis] Length = 91 Score = 59.3 bits (142), Expect = 5e-07 Identities = 21/34 (61%), Positives = 29/34 (85%) Frame = +1 Query: 349 DVFWMKDPKTGNWLPETHFNQVDAVELREKLLSK 450 + FWM+DPKTGNW+PE+HF ++DA +LR K LS+ Sbjct: 52 ETFWMRDPKTGNWIPESHFGEIDAADLRRKFLSR 85 >ref|NP_001236423.1| uncharacterized protein LOC100305512 [Glycine max] gi|255625741|gb|ACU13215.1| unknown [Glycine max] Length = 93 Score = 58.9 bits (141), Expect = 7e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +1 Query: 355 FWMKDPKTGNWLPETHFNQVDAVELREKLL 444 FWM+DPK+GNW+PE HF QVDA ELREK L Sbjct: 52 FWMRDPKSGNWIPENHFGQVDAAELREKFL 81 >ref|XP_003572634.1| PREDICTED: late embryogenesis abundant protein Lea5-like [Brachypodium distachyon] Length = 86 Score = 57.4 bits (137), Expect = 2e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +1 Query: 349 DVFWMKDPKTGNWLPETHFNQVDAVELREKLLSK 450 ++FWM+DPKTGNW+PE F +VDA ELR +LLS+ Sbjct: 43 EIFWMRDPKTGNWIPENRFAEVDAAELRAQLLSR 76 >gb|AAB01566.1| ABA-responsive and embryogenesis-associated gene; LEA-like protein [Picea glauca] Length = 95 Score = 57.0 bits (136), Expect = 3e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +1 Query: 352 VFWMKDPKTGNWLPETHFNQVDAVELREKLLS 447 VFWM+DP TGNW+PE HF + D ELR+KLLS Sbjct: 61 VFWMRDPATGNWIPEDHFGETDTAELRQKLLS 92