BLASTX nr result
ID: Cephaelis21_contig00050116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050116 (420 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulga... 46 4e-06 >emb|CCA65996.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 744 Score = 46.2 bits (108), Expect(2) = 4e-06 Identities = 19/49 (38%), Positives = 32/49 (65%) Frame = -1 Query: 414 PRLPIHFFAKDALFSIVSAIGNPLRMDAATQSLKCPSIARVWVEVDILK 268 P LP+ ++ K+ALF+I +G P+++D AT + ARV +E+D+ K Sbjct: 216 PELPLEYYDKEALFAIAGKVGKPIKVDYATDHMARGRYARVCIELDLAK 264 Score = 29.3 bits (64), Expect(2) = 4e-06 Identities = 8/26 (30%), Positives = 15/26 (57%) Frame = -3 Query: 220 WQKLDFDELPVYCCHCWHVGHHESKC 143 WQ ++++ L + C C +GH +C Sbjct: 276 WQNVEYENLSLVCFLCGKIGHRRDQC 301