BLASTX nr result
ID: Cephaelis21_contig00050026
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cephaelis21_contig00050026 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indi... 57 2e-06 >gb|EEC79285.1| hypothetical protein OsI_20087 [Oryza sativa Indica Group] gi|218196859|gb|EEC79286.1| hypothetical protein OsI_20088 [Oryza sativa Indica Group] Length = 216 Score = 57.0 bits (136), Expect = 2e-06 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 3/77 (3%) Frame = -3 Query: 239 SGQKLALQIAN-ERSQEAEVSNSNTEIGR--KWKALWSQPIKGKVKMFIWKCPHRAIPTK 69 S KLA+QI E+ ++A S+ NT +W+ +W+ + K+KMF+W+ H ++P + Sbjct: 76 SAYKLAVQIREKEKCRDASGSSLNTSHADTLQWEKIWNMEVPNKIKMFVWRLAHNSLPVR 135 Query: 68 FELNRRKIQVDPICSFC 18 + RR ++ D +C C Sbjct: 136 CNIRRRGMESDNLCPMC 152